Identification |
Name: |
Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha |
Synonyms: |
- ACCase subunit alpha
- Acetyl-CoA carboxylase carboxyltransferase subunit alpha
|
Gene Name: |
accA |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in acetyl-CoA carboxylase activity |
Specific Function: |
Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carrier protein (BCCP) and then the CO(2) group is transferred by the carboxyltransferase to acetyl-CoA to form malonyl-CoA |
Cellular Location: |
Cytoplasm |
KEGG Pathways: |
|
KEGG Reactions: |
| | | | |
![Thumb](/molecules/PAMDB000298thumb.png) | + | Carboxybiotin-carboxyl-carrier protein | ↔ | ![Thumb](/molecules/PAMDB000284thumb.png) | + | Holo-[carboxylase] |
| |
|
SMPDB Reactions: |
|
![Thumb](/molecules/PAMDB000298thumb.png) | + | ![Thumb](/molecules/PAMDB000153thumb.png) | + | ![Thumb](/molecules/PAMDB000148thumb.png) | → | Adenosine diphosphate | + | ![Thumb](/molecules/PAMDB000383thumb.png) | + | ![Thumb](/molecules/PAMDB001633thumb.png) | + | Malonyl-CoA | + | ![Thumb](/molecules/PAMDB000345thumb.png) | + | ![Thumb](/molecules/PAMDB000284thumb.png) |
| | |
a biotinylated [BCCP dimer] | + | ![Thumb](/molecules/PAMDB000148thumb.png) | + | ![Thumb](/molecules/PAMDB000153thumb.png) | → | carboxylated-biotinylated [BCCP dimer] | + | ![Thumb](/molecules/PAMDB001633thumb.png) | + | ![Thumb](/molecules/PAMDB000345thumb.png) | + | ![Thumb](/molecules/PAMDB000383thumb.png) |
| |
|
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Component |
---|
acetyl-CoA carboxylase complex | macromolecular complex | protein complex | Function |
---|
acetyl-CoA carboxylase activity | catalytic activity | CoA carboxylase activity | ligase activity | ligase activity, forming carbon-carbon bonds | Process |
---|
carboxylic acid metabolic process | cellular metabolic process | fatty acid biosynthetic process | fatty acid metabolic process | metabolic process | monocarboxylic acid metabolic process | organic acid metabolic process | oxoacid metabolic process |
|
Gene Properties |
Locus tag: |
PA3639 |
Strand: |
- |
Entrez Gene ID: |
880489 |
Accession: |
NP_252329.1 |
GI: |
15598835 |
Sequence start: |
4074057 |
Sequence End: |
4075007 |
Sequence Length: |
950 |
Gene Sequence: |
>PA3639
ATGAACCCGAACTTTCTTGATTTCGAACAGCCGATCGCCGACCTGCAAGCCAAGATCGAAGAGCTGCGCCTGGTGGGCAACGACAATGCGCTGAACATCAGCGACGAAATCTCGCGTCTGCAGGACAAGAGCAAGGCGCTCACCGAAAACATCTTCGGCAATCTGTCCAGTTGGCAGATCGCCCAGCTCGCGCGCCATCCCAAGCGTCCCTATACCCTCGACTACATCGGCTACCTGTTCAGCGATTTCGAGGAACTGCACGGCGACCGGCATTTCGCCGACGACCCGGCGATCGTCGGCGGCGTTGCCCGCCTCGACGGTTCCCCGGTGATGGTCATCGGCCACCAGAAGGGCCGCGAAGTCCGTGAGAAGGTCCGGCGCAACTTCGGCATGCCGCGTCCGGAAGGCTATCGCAAGGCCTGCCGCCTGATGGAAATGGCCGAACGCTTCAAGATGCCGATCCTCACCTTCATCGACACGCCCGGCGCCTACCCGGGGATCGATGCCGAGGAACGCGGCCAGAGCGAGGCGATCGCCTGGAACCTGCGGGTGATGGCGCGACTGAAGACGCCGATCATCGCCACCGTGATCGGCGAGGGCGGTTCCGGCGGCGCGCTGGCCATCGGTGTCTGCGACCAGTTGAACATGCTGCAATACTCCACCTATTCGGTGATCTCGCCGGAAGGCTGCGCCTCCATCCTCTGGAAGACCGCCGAGAAGGCGCCGGAAGCCGCCGAGGCCATGGGCATCACCGCCGAGCGCCTGAAAGGCCTGGGCATCGTCGACAAGGTCATCGACGAACCGCTGGGCGGCGCCCATCGCGATCCGGCGAGCATGGCCGAATCGATCCGTGGCGAACTGCTGGCGCAACTGAAGATGCTCCAGGGCCTGGAAATGGGTGAGTTGCTGGAGCGTCGTTACGACCGCCTGATGAGCTACGGCGCGCCGTAA |
Protein Properties |
Protein Residues: |
316 |
Protein Molecular Weight: |
34.9 kDa |
Protein Theoretical pI: |
5.15 |
Hydropathicity (GRAVY score): |
-0.269 |
Charge at pH 7 (predicted): |
-6.88 |
Protein Sequence: |
>PA3639
MNPNFLDFEQPIADLQAKIEELRLVGNDNALNISDEISRLQDKSKALTENIFGNLSSWQIAQLARHPKRPYTLDYIGYLFSDFEELHGDRHFADDPAIVGGVARLDGSPVMVIGHQKGREVREKVRRNFGMPRPEGYRKACRLMEMAERFKMPILTFIDTPGAYPGIDAEERGQSEAIAWNLRVMARLKTPIIATVIGEGGSGGALAIGVCDQLNMLQYSTYSVISPEGCASILWKTAEKAPEAAEAMGITAERLKGLGIVDKVIDEPLGGAHRDPASMAESIRGELLAQLKMLQGLEMGELLERRYDRLMSYGAP |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA3639 and its homologs
|