Identification |
Name: |
High-affinity branched-chain amino acid transport ATP-binding protein livF |
Synonyms: |
|
Gene Name: |
livF |
Enzyme Class: |
Not Available |
Biological Properties |
General Function: |
Involved in nucleotide binding |
Specific Function: |
Component of the leucine-specific transport system |
Cellular Location: |
Cytoplasmic |
KEGG Pathways: |
|
KEGG Reactions: |
Not Available |
SMPDB Reactions: |
|
![Thumb](/molecules/PAMDB000170thumb.png) | + | ![Thumb](/molecules/PAMDB000148thumb.png) | + | ![Thumb](/molecules/PAMDB000142thumb.png) | → | ![Thumb](/molecules/PAMDB000170thumb.png) | + | Adenosine diphosphate | + | ![Thumb](/molecules/PAMDB000383thumb.png) | + | ![Thumb](/molecules/PAMDB001633thumb.png) | + | ![Thumb](/molecules/PAMDB000345thumb.png) |
| | |
L-Valine | + | ![Thumb](/molecules/PAMDB000148thumb.png) | + | ![Thumb](/molecules/PAMDB000142thumb.png) | + | ![Thumb](/molecules/PAMDB000196thumb.png) | → | L-Valine | + | Adenosine diphosphate | + | Pyrophosphate | + | ![Thumb](/molecules/PAMDB001633thumb.png) | + | ![Thumb](/molecules/PAMDB000345thumb.png) |
| | |
L-Isoleucine | + | ![Thumb](/molecules/PAMDB000148thumb.png) | + | ![Thumb](/molecules/PAMDB000142thumb.png) | + | ![Thumb](/molecules/PAMDB000071thumb.png) | → | L-Isoleucine | + | Adenosine diphosphate | + | ![Thumb](/molecules/PAMDB000383thumb.png) | + | ![Thumb](/molecules/PAMDB001633thumb.png) | + | ![Thumb](/molecules/PAMDB000345thumb.png) |
| |
|
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
adenyl nucleotide binding | adenyl ribonucleotide binding | ATP binding | ATPase activity | binding | catalytic activity | hydrolase activity | hydrolase activity, acting on acid anhydrides | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | nucleoside binding | nucleoside-triphosphatase activity | nucleotide binding | purine nucleoside binding | pyrophosphatase activity |
|
Gene Properties |
Locus tag: |
PA1070 |
Strand: |
- |
Entrez Gene ID: |
878069 |
Accession: |
NP_249761.1 |
GI: |
15596267 |
Sequence start: |
1157954 |
Sequence End: |
1158655 |
Sequence Length: |
701 |
Gene Sequence: |
>PA1070
ATGCTGAGTTTCGACAAGGTTTCCACCTACTACGGCAAGATCCAGGCGCTGCACGACGTCAGCGTGGAAGTGAAGAAGGGCGAGATCGTCACCCTGATCGGCGCCAACGGCGCCGGCAAGTCGACCCTGCTGATGACGCTCTGCGGCTCGCCGCAGGCGGCCAGCGGCAGCATCCGCTACGAAGGCGAGGAACTGGTCGGCCTGCCCTCCTCCACCATCATGCGCAAGAGCATCGCGGTGGTCCCGGAAGGCCGCCGGGTCTTCTCCCGCCTGACGGTGGAAGAAAACCTGGCGATGGGCGGCTTCTTCACCGACAAGGACGACTACCAGGTGCAGATGGACAAGGTGCTGGAACTCTTCCCGCGCCTGAAGGAACGCTACGAACAGCGCGCCGGGACCATGTCCGGCGGCGAACAGCAGATGCTCGCCATCGGCCGCGCGCTGATGAGCAAGCCAAAGCTGTTGCTGTTGGACGAACCTTCGCTCGGCCTGGCGCCGATCATCATCCAGCAGATCTTCGAGATCATCGAGCAGTTGCGTCGCGAAGGCGTCACCGTGTTCCTCGTCGAGCAGAACGCCAACCAGGCGTTGAAGCTCGCCGATCGCGCCTACGTGCTGGAGAACGGCCGGATCGTCATGCACGACACCGGCGCCGCCCTGCTGACCAACCCGAAGGTGCGCGACGCCTACCTCGGCGGCTGA |
Protein Properties |
Protein Residues: |
233 |
Protein Molecular Weight: |
25.6 kDa |
Protein Theoretical pI: |
6.55 |
Hydropathicity (GRAVY score): |
-0.044 |
Charge at pH 7 (predicted): |
-0.55 |
Protein Sequence: |
>PA1070
MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLGG |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA1070 and its homologs
|