Identification |
Name: |
Galactitol permease IIC component |
Synonyms: |
- EIIC-Gat
- PTS system galactitol-specific EIIC component
|
Gene Name: |
gatC |
Enzyme Class: |
Not Available |
Biological Properties |
General Function: |
Involved in phosphoenolpyruvate-dependent sugar phosphotransferase system |
Specific Function: |
The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. This system is involved in galactitol transport |
Cellular Location: |
Cell inner membrane; Multi-pass membrane protein |
KEGG Pathways: |
Not Available |
Transports: | |
---|
Transport References: | - Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
|
KEGG Reactions: |
Not Available |
SMPDB Reactions: |
Not Available |
PseudoCyc/BioCyc Reactions: |
|
![Thumb](/molecules/PAMDB000040thumb.png) | + | Protein N(pi)-phospho-L-histidine | ↔ | ![Thumb](/molecules/PAMDB000996thumb.png) | + | Protein histidine |
| | |
![Thumb](/molecules/PAMDB000040thumb.png) | + | HPr - phosphorylated | → | Galactose 1-phosphate | + | HPr | + | ![Thumb](/molecules/PAMDB000556thumb.png) |
| | | |
|
Complex Reactions: |
Not Available |
Transports: |
|
Metabolites: |
|
GO Classification: |
Component |
---|
cell part | integral to membrane | intrinsic to membrane | membrane part | Process |
---|
carbohydrate transport | establishment of localization | phosphoenolpyruvate-dependent sugar phosphotransferase system | transport |
|
Gene Properties |
Locus tag: |
PA4482 |
Strand: |
+ |
Entrez Gene ID: |
881166 |
Accession: |
NP_253172.1 |
GI: |
15599678 |
Sequence start: |
5013671 |
Sequence End: |
5013961 |
Sequence Length: |
290 |
Gene Sequence: |
>PA4482
ATGGCGCTTGAACGCTCCGACGTGGAAAAAATCGCCCATCTCGCCCGCCTGGGCCTGAGCGAGGCCGATCTTCCGCGCACCACCGAGACCCTGAACAACATCCTCGGCCTGATCGACCAGATGCAGGCGGTCGACACCAGCGGCGTCGAACCGCTCGCCCATCCGCTGGAAGCCACCCAGCGCCTGCGCCCGGACGCGGTCACCGAGACCGATCACCGCGACGCCTACCAGACCATCGCCCCCGCCGTGGAAGAAGGTCTGTACCTGGTTCCGAAAGTCATCGAGTCATAA |
Protein Properties |
Protein Residues: |
96 |
Protein Molecular Weight: |
10.5 kDa |
Protein Theoretical pI: |
4.3 |
Hydropathicity (GRAVY score): |
-0.235 |
Charge at pH 7 (predicted): |
-8.29 |
Protein Sequence: |
>PA4482
MALERSDVEKIAHLARLGLSEADLPRTTETLNNILGLIDQMQAVDTSGVEPLAHPLEATQRLRPDAVTETDHRDAYQTIAPAVEEGLYLVPKVIES |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA4482 and its homologs
|