| Identification |
| Name: |
NADH-quinone oxidoreductase subunit K |
| Synonyms: |
- NADH dehydrogenase I subunit K
- NDH-1 subunit K
- NUO11
|
| Gene Name: |
nuoK |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in oxidoreductase activity, acting on NADH or NADPH |
| Specific Function: |
There are 2 NADH dehydrogenases in E.coli, however only this complex is able to use dNADH (reduced nicotinamide hypoxanthine dinucleotide, deamino-NADH) and dNADH-DB (dimethoxy- 5-methyl-6-decyl-1,4-benzoquinone) as substrates |
| Cellular Location: |
Cell inner membrane; Multi-pass membrane protein |
| KEGG Pathways: |
|
| KEGG Reactions: |
|
 | + | Acceptor | ↔ |  | + | Reduced acceptor |
| | | |
|
| SMPDB Reactions: |
| | |
 | + | 4  | + | 2  | + | menaquinone-8 | ? |  | + |  | + |  | + | Electron | + | 4  |
| | |
"a menaquinone" | + | 4  | + |  | → | "a menaquinol" | + |  |
| | |
4  | + |  | + | "a menaquinone" | → |  | + | "a menaquinol" |
| |
|
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Function |
|---|
| catalytic activity | | oxidoreductase activity | | oxidoreductase activity, acting on NADH or NADPH | | Process |
|---|
| ATP synthesis coupled electron transport | | cellular metabolic process | | electron transport chain | | generation of precursor metabolites and energy | | metabolic process | | oxidation reduction | | respiratory electron transport chain |
|
| Gene Properties |
| Locus tag: |
PA2646 |
| Strand: |
+ |
| Entrez Gene ID: |
882355 |
| Accession: |
NP_251336.1 |
| GI: |
15597842 |
| Sequence start: |
2992548 |
| Sequence End: |
2992856 |
| Sequence Length: |
308 |
| Gene Sequence: |
>PA2646
ATGAACGCAATACCACTGGAACACGGCCTGGCCCTCGCCAGCGTCCTGTTCGCCCTCGGACTGGTCGGCTTGATGGTGCGACGCAACATCCTGTTCGTACTGATGAGCCTGGAAGTGATGATGAACGCCGCCGCCCTCGCCTTCGTGGTCGCCGGCAGCCGCTGGGGCCAACCCGACGGCCAGGTGATGTTCATCCTGGTGCTGAGCCTCGCGGCCGCCGAAGCGAGCATCGGCCTGGCGATCCTGCTGCAACTGTATCGCCGCTTCCACACCCTCGATATCGACGCTGCCAGCGAGATGCGCGGATGA |
| Protein Properties |
| Protein Residues: |
102 |
| Protein Molecular Weight: |
11 kDa |
| Protein Theoretical pI: |
6.51 |
| Hydropathicity (GRAVY score): |
0.981 |
| Charge at pH 7 (predicted): |
-0.54 |
| Protein Sequence: |
>PA2646
MNAIPLEHGLALASVLFALGLVGLMVRRNILFVLMSLEVMMNAAALAFVVAGSRWGQPDGQVMFILVLSLAAAEASIGLAILLQLYRRFHTLDIDAASEMRG |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA2646 and its homologs
|