Identification |
Name: |
NADH-quinone oxidoreductase subunit K |
Synonyms: |
- NADH dehydrogenase I subunit K
- NDH-1 subunit K
- NUO11
|
Gene Name: |
nuoK |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in oxidoreductase activity, acting on NADH or NADPH |
Specific Function: |
There are 2 NADH dehydrogenases in E.coli, however only this complex is able to use dNADH (reduced nicotinamide hypoxanthine dinucleotide, deamino-NADH) and dNADH-DB (dimethoxy- 5-methyl-6-decyl-1,4-benzoquinone) as substrates |
Cellular Location: |
Cell inner membrane; Multi-pass membrane protein |
KEGG Pathways: |
|
KEGG Reactions: |
|
| + | Acceptor | ↔ | | + | Reduced acceptor |
| | | |
|
SMPDB Reactions: |
| | |
| + | 4 | + | 2 | + | menaquinone-8 | ? | | + | | + | | + | Electron | + | 4 |
| | |
"a menaquinone" | + | 4 | + | | → | "a menaquinol" | + | |
| | |
4 | + | | + | "a menaquinone" | → | | + | "a menaquinol" |
| |
|
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
catalytic activity | oxidoreductase activity | oxidoreductase activity, acting on NADH or NADPH | Process |
---|
ATP synthesis coupled electron transport | cellular metabolic process | electron transport chain | generation of precursor metabolites and energy | metabolic process | oxidation reduction | respiratory electron transport chain |
|
Gene Properties |
Locus tag: |
PA2646 |
Strand: |
+ |
Entrez Gene ID: |
882355 |
Accession: |
NP_251336.1 |
GI: |
15597842 |
Sequence start: |
2992548 |
Sequence End: |
2992856 |
Sequence Length: |
308 |
Gene Sequence: |
>PA2646
ATGAACGCAATACCACTGGAACACGGCCTGGCCCTCGCCAGCGTCCTGTTCGCCCTCGGACTGGTCGGCTTGATGGTGCGACGCAACATCCTGTTCGTACTGATGAGCCTGGAAGTGATGATGAACGCCGCCGCCCTCGCCTTCGTGGTCGCCGGCAGCCGCTGGGGCCAACCCGACGGCCAGGTGATGTTCATCCTGGTGCTGAGCCTCGCGGCCGCCGAAGCGAGCATCGGCCTGGCGATCCTGCTGCAACTGTATCGCCGCTTCCACACCCTCGATATCGACGCTGCCAGCGAGATGCGCGGATGA |
Protein Properties |
Protein Residues: |
102 |
Protein Molecular Weight: |
11 kDa |
Protein Theoretical pI: |
6.51 |
Hydropathicity (GRAVY score): |
0.981 |
Charge at pH 7 (predicted): |
-0.54 |
Protein Sequence: |
>PA2646
MNAIPLEHGLALASVLFALGLVGLMVRRNILFVLMSLEVMMNAAALAFVVAGSRWGQPDGQVMFILVLSLAAAEASIGLAILLQLYRRFHTLDIDAASEMRG |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA2646 and its homologs
|