| Identification |
| Name: |
NADH-quinone oxidoreductase subunit E |
| Synonyms: |
- NADH dehydrogenase I subunit E
- NDH-1 subunit E
- NUO5
|
| Gene Name: |
nuoE |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in oxidoreductase activity |
| Specific Function: |
NDH-1 shuttles electrons from NADH, via FMN and iron- sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient |
| Cellular Location: |
Not Available |
| KEGG Pathways: |
|
| KEGG Reactions: |
|
 | + | Acceptor | ↔ |  | + | Reduced acceptor |
| | | |
|
| SMPDB Reactions: |
| | |
 | + | 4  | + | 2 | + | menaquinone-8 | ? |  | + | | + |  | + | Electron | + | 4 |
| | |
"a menaquinone" | + | 4 | + | | → | "a menaquinol" | + | |
| | |
4 | + | | + | "a menaquinone" | → | | + | "a menaquinol" |
| |
|
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Function |
|---|
| binding | | catalytic activity | | NAD or NADH binding | | nucleotide binding | | oxidoreductase activity | | Process |
|---|
| metabolic process | | oxidation reduction |
|
| Gene Properties |
| Locus tag: |
PA2640 |
| Strand: |
+ |
| Entrez Gene ID: |
882347 |
| Accession: |
NP_251330.1 |
| GI: |
15597836 |
| Sequence start: |
2985746 |
| Sequence End: |
2986246 |
| Sequence Length: |
500 |
| Gene Sequence: |
>PA2640
ATGAGCCAGAGCAACCTGATTCAGACCGACCGTTTCGTCCTCAGCGAAACCGAGCGCTCGTCCATCGAGCATGAAATGCATCACTACGAGGACCCGCGCGCGGCGTCCATCGAAGCCCTGAAGATCGTCCAGAAACAGCGCGGCTGGGTGCCGGACGGCGCCATCCCGGCGATCGGCGAGGTGCTGGGGATCCCGGCCAGCGACGTCGAAGGCGTCGCCACCTTCTATAGTCAGATATTCCGCCAGCCGGTGGGCCGCCACATCATCCGCGTCTGCGACAGCATGGTCTGCTACATCGGCGGCCACGAGTCGGTGGTCGGCGAGATCCAGAAGCAACTCGGCATCGGTCTCGGCCAGACTACCGCCGACGGACGCTTCACCCTGCTCCCGGTCTGCTGCCTGGGCAACTGCGACAAGGCCCCGGCGCTGATGATCGACGACGACACCCATGGCGACGTGCGTCCCGACGGTGTCGCCAAACTGCTGGAGGCCTACGTATGA |
| Protein Properties |
| Protein Residues: |
166 |
| Protein Molecular Weight: |
18.1 kDa |
| Protein Theoretical pI: |
4.82 |
| Hydropathicity (GRAVY score): |
-0.072 |
| Charge at pH 7 (predicted): |
-7.72 |
| Protein Sequence: |
>PA2640
MSQSNLIQTDRFVLSETERSSIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIPAIGEVLGIPASDVEGVATFYSQIFRQPVGRHIIRVCDSMVCYIGGHESVVGEIQKQLGIGLGQTTADGRFTLLPVCCLGNCDKAPALMIDDDTHGDVRPDGVAKLLEAYV |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA2640 and its homologs
|
