ATP synthase protein I (PA5561)

Identification
Name: ATP synthase protein I
Synonyms: Not Available
Gene Name: atpI
Enzyme Class: Not Available
Biological Properties
General Function: Energy production and conversion
Specific Function: A possible function for this protein is to guide the assembly of the membrane sector of the ATPase enzyme complex
Cellular Location: Cell inner membrane; Multi-pass membrane protein
KEGG Pathways:
  • adenosine ribonucleotides de novo biosynthesis PWY-7219
  • superpathway of adenosine nucleotides de novo biosynthesis I PWY-7229
  • superpathway of purine nucleotides de novo biosynthesis I PWY-841
  • superpathway of adenosine nucleotides de novo biosynthesis II PWY-6126
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Thumb
    ATP + H+[cytosol] + H2O ↔ ADP + phosphate + H+[periplasm]
    ReactionCard
    PAMDB001633+PAMDB110477+PAMDB000142 → PAMDB001633+PAMDB110479+PAMDB110244
    Hydrogen ion + ATP + Water → Hydrogen ion + ADP + phosphate
    ReactionCard
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites:
    PAMDB IDNameView
    PAMDB000148Adenosine triphosphateMetaboCard
    PAMDB000345ADPMetaboCard
    PAMDB001633Hydrogen ionMetaboCard
    PAMDB000383PhosphateMetaboCard
    PAMDB000142WaterMetaboCard
    GO Classification:
    Component
    macromolecular complex
    protein complex
    proton-transporting ATP synthase complex, coupling factor F(o)
    proton-transporting two-sector ATPase complex, proton-transporting domain
    Function
    cation transmembrane transporter activity
    hydrogen ion transmembrane transporter activity
    inorganic cation transmembrane transporter activity
    ion transmembrane transporter activity
    monovalent inorganic cation transmembrane transporter activity
    substrate-specific transmembrane transporter activity
    transmembrane transporter activity
    transporter activity
    Process
    ATP biosynthetic process
    ATP synthesis coupled proton transport
    cellular nitrogen compound metabolic process
    metabolic process
    nitrogen compound metabolic process
    nucleobase, nucleoside and nucleotide metabolic process
    nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
    nucleoside phosphate metabolic process
    nucleotide metabolic process
    purine nucleoside triphosphate biosynthetic process
    purine nucleotide biosynthetic process
    purine nucleotide metabolic process
    purine ribonucleoside triphosphate biosynthetic process
    Gene Properties
    Locus tag: PA5561
    Strand: -
    Entrez Gene ID: 878128
    Accession: NP_254248.1
    GI: 15600754
    Sequence start: 6254428
    Sequence End: 6254808
    Sequence Length: 380
    Gene Sequence: 
    >PA5561
ATGCCAAGTCGCCTGCCGGCATTCAGATTGCTGCTCGTCCAACTGGTAGTAGTGCTTGTTGCTGCGATCTCCCTGTGGATTTCTTGGGGACCGGTAGCCGGATATTCCGGACTGCTGGGAGGGATGATCGCCTGGTTGCCGAATTGTTATTTCGCCTACAAGGCGTTCCGTTTCAGCGGAGCGCGGGCTGCCCGGGAAATCGTTCGCTCTTTCTATGCGGGCGAAGCCGGGAAACTGATTCTGACGGCGGTGCTCTTCGCACTGGCGTTCGCAGGCGTGAAGCCACTGATGGCGCCGGCTCTGTTCGGTGTCTATCTGCTGACCCTGATGGTCAGCTGGTGCGCACCCCTGCTGATGGGAAAAACATTTACAAGACCTTAG
    Protein Properties
    Protein Residues: 126
    Protein Molecular Weight: 13.7 kDa
    Protein Theoretical pI: 10.73
    Hydropathicity (GRAVY score): 0.997
    Charge at pH 7 (predicted): 8.91
    Protein Sequence: 
    >PA5561
MPSRLPAFRLLLVQLVVVLVAAISLWISWGPVAGYSGLLGGMIAWLPNCYFAYKAFRFSGARAAREIVRSFYAGEAGKLILTAVLFALAFAGVKPLMAPALFGVYLLTLMVSWCAPLLMGKTFTRP
    References
    External Links:
    Resource Link
    Genome ID: PA5561
    Entrez Gene ID: 878128
    NCBI Protein ID: 15600754
    General Reference: PaperBLAST - Find papers about PA5561 and its homologs