ATP synthase subunit delta (PA5557)

Identification
Name: ATP synthase subunit delta
Synonyms:
  • ATP synthase F(1) sector subunit delta
  • F-type ATPase subunit delta
  • F-ATPase subunit delta
Gene Name: atpH
Enzyme Class: Not Available
Biological Properties
General Function: Involved in hydrogen ion transporting ATP synthase activity, rotational mechanism
Specific Function: This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction
Cellular Location: Cell inner membrane; Peripheral membrane protein
KEGG Pathways:
  • Oxidative phosphorylation PW000919
  • adenosine ribonucleotides de novo biosynthesis PWY-7219
  • superpathway of adenosine nucleotides de novo biosynthesis I PWY-7229
  • superpathway of purine nucleotides de novo biosynthesis I PWY-841
  • superpathway of adenosine nucleotides de novo biosynthesis II PWY-6126
    KEGG Reactions: Not Available
    SMPDB Reactions:
    Adenosine diphosphate+Thumb+4 Thumb+Thumb ↔ Thumb+3 Thumb+Thumb
    Adenosine diphosphate + Phosphate + 4 Hydrogen ion + ADP ↔ Water + 3 Hydrogen ion + Adenosine triphosphate
    ReactionCard
    PseudoCyc/BioCyc Reactions:
    Adenosine diphosphate+Thumb+4 Thumb+Thumb ↔ Thumb+3 Thumb+Thumb
    Adenosine diphosphate + Phosphate + 4 Hydrogen ion + ADP ↔ Water + 3 Hydrogen ion + Adenosine triphosphate
    ReactionCard
    Thumb
    ATP + H+[cytosol] + H2O ↔ ADP + phosphate + H+[periplasm]
    ReactionCard
    PAMDB001633+PAMDB110477+PAMDB000142 → PAMDB001633+PAMDB110479+PAMDB110244
    Hydrogen ion + ATP + Water → Hydrogen ion + ADP + phosphate
    ReactionCard
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites:
    PAMDB IDNameView
    PAMDB000148Adenosine triphosphateMetaboCard
    PAMDB000345ADPMetaboCard
    PAMDB001633Hydrogen ionMetaboCard
    PAMDB000383PhosphateMetaboCard
    PAMDB000142WaterMetaboCard
    GO Classification:
    Component
    cell part
    macromolecular complex
    membrane
    plasma membrane
    protein complex
    proton-transporting ATP synthase complex, catalytic core F(1)
    proton-transporting two-sector ATPase complex, catalytic domain
    Function
    cation transmembrane transporter activity
    hydrogen ion transmembrane transporter activity
    hydrogen ion transporting ATP synthase activity, rotational mechanism
    inorganic cation transmembrane transporter activity
    ion transmembrane transporter activity
    monovalent inorganic cation transmembrane transporter activity
    substrate-specific transmembrane transporter activity
    transmembrane transporter activity
    transporter activity
    Process
    ATP biosynthetic process
    ATP synthesis coupled proton transport
    cellular nitrogen compound metabolic process
    metabolic process
    nitrogen compound metabolic process
    nucleobase, nucleoside and nucleotide metabolic process
    nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
    nucleoside phosphate metabolic process
    nucleotide metabolic process
    purine nucleoside triphosphate biosynthetic process
    purine nucleotide biosynthetic process
    purine nucleotide metabolic process
    purine ribonucleoside triphosphate biosynthetic process
    Gene Properties
    Locus tag: PA5557
    Strand: -
    Entrez Gene ID: 878509
    Accession: NP_254244.1
    GI: 15600750
    Sequence start: 6252159
    Sequence End: 6252695
    Sequence Length: 536
    Gene Sequence: 
    >PA5557
ATGGCAGAACTGACCACGTTGGCTCGTCCCTACGCAAAGGCGGCTTTCGAGTACGCCCAGGCTCATCAGCAACTGGCCGATTGGTCGGCTGCGCTGGGTGTGCTGGCCGCAGTGTCGCAGGACGACACCGTGCGCCAGCTGCTCAAAGAGCCTCAGCTGACCTCTTCGGCCAAGGCCCAGAGCCTGATCGATGTGTGCGGCGACAAGCTGAATGCACCAGCCCAGAACTTCGTCCGGACTGTGGCTGAGAACAAGCGGCTCGAACTGCTGCCGACCATCGCTGAGATGTACGAGCAGTTGAAGGCCGAGCAGGAAAAGTCGGTCGAGGTAGAAGTCACCAGTGCCTTCACCTTGAGCAAAGAACAGCAGGACAAACTCGCCAAGGCTCTCAGCGCCCGGCTCAGTCGCGAAGTGCGGCTACATGCGTCGGAAGACGCGAGCCTGATCGGCGGCGTGATCATTCGCGCCGGTGACTTGGTAATCGATGGCTCGGTGCGCGGCAAGCTCGCGAAACTGGCCGAAGCGTTGAAATCTTGA
    Protein Properties
    Protein Residues: 178
    Protein Molecular Weight: 19.3 kDa
    Protein Theoretical pI: 5.85
    Hydropathicity (GRAVY score): -0.142
    Charge at pH 7 (predicted): -1.55
    Protein Sequence: 
    >PA5557
MAELTTLARPYAKAAFEYAQAHQQLADWSAALGVLAAVSQDDTVRQLLKEPQLTSSAKAQSLIDVCGDKLNAPAQNFVRTVAENKRLELLPTIAEMYEQLKAEQEKSVEVEVTSAFTLSKEQQDKLAKALSARLSREVRLHASEDASLIGGVIIRAGDLVIDGSVRGKLAKLAEALKS
    References
    External Links:
    Resource Link
    Genome ID: PA5557
    Entrez Gene ID: 878509
    NCBI Protein ID: 15600750
    General Reference: PaperBLAST - Find papers about PA5557 and its homologs