Identification
Name: ATP synthase epsilon chain
Synonyms:
  • ATP synthase F1 sector epsilon subunit
  • F-ATPase epsilon subunit
Gene Name: atpC
Enzyme Class: Not Available
Biological Properties
General Function: Involved in hydrogen ion transporting ATP synthase activity, rotational mechanism
Specific Function: Produces ATP from ADP in the presence of a proton gradient across the membrane
Cellular Location: Cell inner membrane; Peripheral membrane protein
KEGG Pathways:
  • Oxidative phosphorylation PW000919
  • adenosine ribonucleotides de novo biosynthesis PWY-7219
  • superpathway of adenosine nucleotides de novo biosynthesis I PWY-7229
  • superpathway of purine nucleotides de novo biosynthesis I PWY-841
  • superpathway of adenosine nucleotides de novo biosynthesis II PWY-6126
    KEGG Reactions: Not Available
    SMPDB Reactions:
    Adenosine diphosphate+Thumb+4 Thumb+Thumb ↔ Thumb+3 Thumb+Thumb
    PseudoCyc/BioCyc Reactions:
    Adenosine diphosphate+Thumb+4 Thumb+Thumb ↔ Thumb+3 Thumb+Thumb
    Thumb
    ATP + H+[cytosol] + H2O ↔ ADP + phosphate + H+[periplasm]
    ReactionCard
    PAMDB001633+PAMDB110477+PAMDB000142 → PAMDB001633+PAMDB110479+PAMDB110244
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites:
    PAMDB IDNameView
    PAMDB000148Adenosine triphosphateMetaboCard
    PAMDB000345ADPMetaboCard
    PAMDB001633Hydrogen ionMetaboCard
    PAMDB000383PhosphateMetaboCard
    PAMDB000142WaterMetaboCard
    GO Classification:
    Component
    macromolecular complex
    protein complex
    proton-transporting ATP synthase complex, catalytic core F(1)
    proton-transporting two-sector ATPase complex, catalytic domain
    Function
    cation transmembrane transporter activity
    hydrogen ion transmembrane transporter activity
    hydrogen ion transporting ATP synthase activity, rotational mechanism
    inorganic cation transmembrane transporter activity
    ion transmembrane transporter activity
    monovalent inorganic cation transmembrane transporter activity
    proton-transporting ATPase activity, rotational mechanism
    substrate-specific transmembrane transporter activity
    transmembrane transporter activity
    transporter activity
    Process
    ATP biosynthetic process
    ATP synthesis coupled proton transport
    cellular nitrogen compound metabolic process
    metabolic process
    nitrogen compound metabolic process
    nucleobase, nucleoside and nucleotide metabolic process
    nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
    nucleoside phosphate metabolic process
    nucleotide metabolic process
    purine nucleoside triphosphate biosynthetic process
    purine nucleotide biosynthetic process
    purine nucleotide metabolic process
    purine ribonucleoside triphosphate biosynthetic process
    Gene Properties
    Locus tag: PA5553
    Strand: -
    Entrez Gene ID: 878082
    Accession: NP_254240.1
    GI: 15600746
    Sequence start: 6247811
    Sequence End: 6248236
    Sequence Length: 425
    Gene Sequence:
    >PA5553
    ATGGCCATAACAGTCCATTGCGACATCGTCAGCGCCGAGGCGGAGATCTTCTCCGGCCTGGTCGAGATGGTTATCGCGCACGGCGCTCTGGGTGACCTGGGTATCGCCCCGGGCCACGCGCCGCTGATCACCGACCTGAAACCGGGCCCTATCCGCCTGGTCAAGCAGGGCGGCGAGCAGGAGGTGTACTACATCTCCGGCGGTTTCCTCGAAGTCCAGCCGAACATGGTCAAGGTCCTCGCCGACACCGTGGTTCGTGCCGGCGACCTCGACGAAGCGGCCGCCCAGGAAGCCCTGAAGGCTGCCGAAAAGGCGCTGCAGGGCAAGGGCGCCGAGTTCGACTACAGCGCCGCTGCCGCGCGTCTGGCCGAAGCCGCAGCCCAGCTGCGCACCGTCCAGCAACTGCGCAAGAAGTTCGGCGGCTGA
    Protein Properties
    Protein Residues: 141
    Protein Molecular Weight: 14.7 kDa
    Protein Theoretical pI: 4.93
    Hydropathicity (GRAVY score): 0.158
    Charge at pH 7 (predicted): -4.32
    Protein Sequence:
    >PA5553
    MAITVHCDIVSAEAEIFSGLVEMVIAHGALGDLGIAPGHAPLITDLKPGPIRLVKQGGEQEVYYISGGFLEVQPNMVKVLADTVVRAGDLDEAAAQEALKAAEKALQGKGAEFDYSAAAARLAEAAAQLRTVQQLRKKFGG
    References
    External Links:
    Resource Link
    Genome ID: PA5553
    Entrez Gene ID: 878082
    NCBI Protein ID: 15600746
    General Reference: PaperBLAST - Find papers about PA5553 and its homologs