Identification |
Name: |
DNA-directed RNA polymerase subunit omega |
Synonyms: |
- RNAP omega subunit
- RNA polymerase omega subunit
- Transcriptase subunit omega
|
Gene Name: |
rpoZ |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in DNA-directed RNA polymerase activity |
Specific Function: |
Promotes RNA polymerase assembly. Latches the N- and C- terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits |
Cellular Location: |
Cytoplasmic |
KEGG Pathways: |
|
KEGG Reactions: |
|
| + | RNA | + | RNA | ↔ | | + | RNA |
| | |
| + | RNA | ↔ | | + | RNA |
| | |
| + | RNA | ↔ | | + | RNA |
| | |
| + | RNA | ↔ | | + | RNA |
| | |
Nucleoside triphosphate | + | RNA | ↔ | |
| |
|
SMPDB Reactions: |
Not Available |
PseudoCyc/BioCyc Reactions: |
|
| + | RNA | + | RNA | ↔ | | + | RNA |
| | |
| + | RNA | ↔ | | + | RNA |
| | |
| + | RNA | ↔ | | + | RNA |
| | |
| + | RNA | ↔ | | + | RNA |
| | |
Nucleoside triphosphate | + | RNA(n) | → | | + | RNA(n+1) |
| | |
Nucleoside triphosphate | + | RNA | ↔ | |
| |
|
Complex Reactions: |
|
Nucleoside triphosphate | + | RNA(n) | → | | + | RNA(n+1) |
| |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
binding | catalytic activity | DNA binding | DNA-directed RNA polymerase activity | nucleic acid binding | nucleotidyltransferase activity | RNA polymerase activity | transferase activity | transferase activity, transferring phosphorus-containing groups | Process |
---|
biosynthetic process | cellular macromolecule biosynthetic process | macromolecule biosynthetic process | metabolic process | transcription | transcription, DNA-dependent |
|
Gene Properties |
Locus tag: |
PA5337 |
Strand: |
+ |
Entrez Gene ID: |
878048 |
Accession: |
NP_254024.1 |
GI: |
15600530 |
Sequence start: |
6005899 |
Sequence End: |
6006165 |
Sequence Length: |
266 |
Gene Sequence: |
>PA5337
ATGGCCCGCGTCACCGTTGAAGACTGCCTGGACAACGTCGATAACCGTTTCGAGCTGGTCATGCTCGCCACCAAGCGCGCCCGTCAGCTGGCTACCGGCGGCAAGGAGCCGAAAGTGGCCTGGGAAAACGACAAGCCGACCGTCGTCGCCCTGCGCGAGATCGCTTCCGGCCTGGTCGATGAGAACGTCGTCCAGCAGGAAGACATCGTCGAGGACGAACCGCTGTTCGCAGCGTTCGACGACGAGGCCAACACCGAGGCCCTGTAA |
Protein Properties |
Protein Residues: |
88 |
Protein Molecular Weight: |
9.8 kDa |
Protein Theoretical pI: |
3.95 |
Hydropathicity (GRAVY score): |
-0.309 |
Charge at pH 7 (predicted): |
-11.03 |
Protein Sequence: |
>PA5337
MARVTVEDCLDNVDNRFELVMLATKRARQLATGGKEPKVAWENDKPTVVALREIASGLVDENVVQQEDIVEDEPLFAAFDDEANTEAL |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA5337 and its homologs
|