Identification |
Name: |
Molybdopterin synthase sulfur carrier subunit |
Synonyms: |
- MPT synthase subunit 1
- Molybdenum cofactor biosynthesis protein D
- Molybdopterin-converting factor small subunit
- Molybdopterin-converting factor subunit 1
- Sulfur carrier protein moaD
|
Gene Name: |
moaD |
Enzyme Class: |
Not Available |
Biological Properties |
General Function: |
Involved in Mo-molybdopterin cofactor biosynthetic process |
Specific Function: |
Involved in sulfur transfer in the conversion of molybdopterin precursor Z to molybdopterin |
Cellular Location: |
Not Available |
KEGG Pathways: |
|
KEGG Reactions: |
|
| + | 2 Sulfur donor | ↔ | |
| |
|
SMPDB Reactions: |
|
| + | | + | thiocarboxylated small subunit of molybdopterin synthase | → | 4 | + | 2 thiocarboxylated small subunit of molybdopterin synthase | + | Molybdopterin | + | |
| |
|
PseudoCyc/BioCyc Reactions: |
|
| + | 2 Sulfur donor | ↔ | |
| | |
| + | | + | thiocarboxylated small subunit of molybdopterin synthase | → | 4 | + | 2 thiocarboxylated small subunit of molybdopterin synthase | + | Molybdopterin | + | |
| |
|
Complex Reactions: |
|
| + | | + | 2 MoaD Protein with thiocarboxylate | → | 5 | + | 2 MoaD Protein with carboxylate | + | |
| | |
IscS with bound sulfur | + | MoaD Protein with bound AMP | + | | → | | + | IscS sulfur acceptor protein | + | MoaD Protein with thiocarboxylate | + | |
| |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Process |
---|
cellular metabolic process | coenzyme biosynthetic process | coenzyme metabolic process | cofactor metabolic process | metabolic process | Mo-molybdopterin cofactor biosynthetic process | sulfur metabolic process |
|
Gene Properties |
Locus tag: |
PA3917 |
Strand: |
- |
Entrez Gene ID: |
879013 |
Accession: |
NP_252606.1 |
GI: |
15599112 |
Sequence start: |
4386357 |
Sequence End: |
4386608 |
Sequence Length: |
251 |
Gene Sequence: |
>PA3917
ATGATCCGCGTGCAGTATTTCGCCCGTTACCGCGAAGCCCTCGGCATCGACGGCGAGCAGTTGAACTGGGACGCCGGGCTGGCGACCCTCGGCGCCTTGCGCCAGCTCCTGGTGGAGCGCGGCGGGGCCTGGGAGCGTACCCTCGGCGAGCAGAACCTGATGTGCGCGCGCAATCAGGAACTGTGCGGCCTCGACGAGCCGTTGCAGGACGGCGACGAAGTCGCCTTCTTCCCCACCGTCACCGGAGGTTGA |
Protein Properties |
Protein Residues: |
83 |
Protein Molecular Weight: |
9.2 kDa |
Protein Theoretical pI: |
4.12 |
Hydropathicity (GRAVY score): |
-0.245 |
Charge at pH 7 (predicted): |
-6.07 |
Protein Sequence: |
>PA3917
MIRVQYFARYREALGIDGEQLNWDAGLATLGALRQLLVERGGAWERTLGEQNLMCARNQELCGLDEPLQDGDEVAFFPTVTGG |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA3917 and its homologs
|