Identification |
Name: |
Nitrite reductase [NAD(P)H] small subunit |
Synonyms: |
Not Available |
Gene Name: |
nirD |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in nitrite reductase [NAD(P)H] activity |
Specific Function: |
Required for activity of the reductase |
Cellular Location: |
Cytoplasm |
KEGG Pathways: |
|
KEGG Reactions: |
|
SMPDB Reactions: |
|
PseudoCyc/BioCyc Reactions: |
| | | | | 2 nitric oxide + an oxidized unknown electron acceptor + 2 H 2O = 2 nitrite + an reduced unknown electron acceptor ReactionCard |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
2 iron, 2 sulfur cluster binding | binding | catalytic activity | iron-sulfur cluster binding | metal cluster binding | nitrite reductase [NAD(P)H] activity | oxidoreductase activity | oxidoreductase activity, acting on other nitrogenous compounds as donors | oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor | Process |
---|
metabolic process | nitrate assimilation | nitrate metabolic process | nitrogen compound metabolic process | oxidation reduction |
|
Gene Properties |
Locus tag: |
PA1780 |
Strand: |
- |
Entrez Gene ID: |
878289 |
Accession: |
NP_250471.1 |
GI: |
15596977 |
Sequence start: |
1925797 |
Sequence End: |
1926123 |
Sequence Length: |
326 |
Gene Sequence: |
>PA1780
ATGAACTGGCTGGATATCTGCTCCCTCGATGAAATCAACCCGCTGGGCTCGCGCGTGGTCGCCGGCCCGAAAGGCGACATCGCCATCTTCCGCGCCGCCGACGACCAGGTCTTCGCCCTCGATGACCGCTGCCCGCACAAGGGCGGCCCGCTGTCCCAGGGCCTGATCTACGGCAAGCGAGTGGCCTGTCCGTTGCACAACTGGCAGATTGAACTGGAGAGCGGCGAAGCCGTGGCCCCGGACCAGGGCTGCGCCCATCGCCACCCGGTGCGGGTGGAGAACGGACGGGTGCTGCTCGGCCTGGACAGCGTGGCGCTGTGCGCCTGA |
Protein Properties |
Protein Residues: |
108 |
Protein Molecular Weight: |
11.6 kDa |
Protein Theoretical pI: |
5.53 |
Hydropathicity (GRAVY score): |
-0.051 |
Charge at pH 7 (predicted): |
-3.2 |
Protein Sequence: |
>PA1780
MNWLDICSLDEINPLGSRVVAGPKGDIAIFRAADDQVFALDDRCPHKGGPLSQGLIYGKRVACPLHNWQIELESGEAVAPDQGCAHRHPVRVENGRVLLGLDSVALCA |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA1780 and its homologs
|