Identification |
Name: |
Cytochrome c biogenesis ATP-binding export protein CcmA |
Synonyms: |
|
Gene Name: |
ccmA |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in nucleotide binding |
Specific Function: |
Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system |
Cellular Location: |
Cell inner membrane; Peripheral membrane protein |
KEGG Pathways: |
|
KEGG Reactions: |
Not Available |
SMPDB Reactions: |
Not Available |
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Component |
---|
cell part | outer membrane-bounded periplasmic space | periplasmic space | Function |
---|
adenyl nucleotide binding | adenyl ribonucleotide binding | ATP binding | ATPase activity | binding | catalytic activity | hydrolase activity | hydrolase activity, acting on acid anhydrides | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | nucleoside binding | nucleoside-triphosphatase activity | nucleotide binding | purine nucleoside binding | pyrophosphatase activity | transporter activity | Process |
---|
cellular component assembly | cellular component organization | cellular component organization or biogenesis | cellular protein complex assembly | cytochrome complex assembly | macromolecular complex assembly | protein complex assembly |
|
Gene Properties |
Locus tag: |
PA1475 |
Strand: |
+ |
Entrez Gene ID: |
880978 |
Accession: |
NP_250166.1 |
GI: |
15596672 |
Sequence start: |
1602179 |
Sequence End: |
1602880 |
Sequence Length: |
701 |
Gene Sequence: |
>PA1475
ATGTCCGATCCTGCTGAAGTCCCCACAGCCAGCCCCTTGCTGGAAACCGTCGGGCTCGCCTGCGAGCGCGACTGGCGCATGCTGTTCGAGCGCCTCGACCTGCGCCTGGCCGCCGGCGAGATGTTGCAGGTGGTGGGTCCCAACGGCAGCGGCAAGACCAGCCTGCTGCGCCTGCTGTCCGGACTGATGCAGCCGACCGCCGGGGAAGTCCGCCTGAACGGCCGGCCGCTCGCCGAACAGCGCGGCGAACTGGCCCGCAGCCTGTTGTGGATCGGCCACGCCGCGGGAATCAAGGGCCTGCTCAGCGCCGAGGAGAACCTCACCTGGCTCTGCGCGCTGCACCAGCCGGCCAGCCGCGAGGCGATCTGGCAGGCCCTGGCCGACGTCGGCCTGCGTGGCTTCGAGGACGTTCCCTGTCACACCCTTTCCGCCGGCCAGCAACGCCGCGTGGCGCTGGCCCGCCTGTACCTGGACGCACCGCCCTTGTGGATCCTCGATGAACCCTTCACCGCCCTCGACAAACAGGGGGTGGCGCAACTGGAAACGCACCTGGCCGGGCATTGCCAGCGCGGCGGGATGGTGGTGCTGACCACCCACCACAGCCTGCAGCAGGTGCCCGCCGGCTACCGCGAGCTGGACCTTGGTGCGCTCAAGGCGGCCAGCGGCGCGACGGTCGAGCCGGCGCTGGGCGACCCGGCATGA |
Protein Properties |
Protein Residues: |
233 |
Protein Molecular Weight: |
25 kDa |
Protein Theoretical pI: |
5.88 |
Hydropathicity (GRAVY score): |
-0.009 |
Charge at pH 7 (predicted): |
-4.44 |
Protein Sequence: |
>PA1475
MSDPAEVPTASPLLETVGLACERDWRMLFERLDLRLAAGEMLQVVGPNGSGKTSLLRLLSGLMQPTAGEVRLNGRPLAEQRGELARSLLWIGHAAGIKGLLSAEENLTWLCALHQPASREAIWQALADVGLRGFEDVPCHTLSAGQQRRVALARLYLDAPPLWILDEPFTALDKQGVAQLETHLAGHCQRGGMVVLTTHHSLQQVPAGYRELDLGALKAASGATVEPALGDPA |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA1475 and its homologs
|