| Identification |
| Name: |
Cytochrome c biogenesis ATP-binding export protein CcmA |
| Synonyms: |
|
| Gene Name: |
ccmA |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in nucleotide binding |
| Specific Function: |
Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system |
| Cellular Location: |
Cell inner membrane; Peripheral membrane protein |
| KEGG Pathways: |
|
| KEGG Reactions: |
Not Available |
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Component |
|---|
| cell part | | outer membrane-bounded periplasmic space | | periplasmic space | | Function |
|---|
| adenyl nucleotide binding | | adenyl ribonucleotide binding | | ATP binding | | ATPase activity | | binding | | catalytic activity | | hydrolase activity | | hydrolase activity, acting on acid anhydrides | | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | | nucleoside binding | | nucleoside-triphosphatase activity | | nucleotide binding | | purine nucleoside binding | | pyrophosphatase activity | | transporter activity | | Process |
|---|
| cellular component assembly | | cellular component organization | | cellular component organization or biogenesis | | cellular protein complex assembly | | cytochrome complex assembly | | macromolecular complex assembly | | protein complex assembly |
|
| Gene Properties |
| Locus tag: |
PA1475 |
| Strand: |
+ |
| Entrez Gene ID: |
880978 |
| Accession: |
NP_250166.1 |
| GI: |
15596672 |
| Sequence start: |
1602179 |
| Sequence End: |
1602880 |
| Sequence Length: |
701 |
| Gene Sequence: |
>PA1475
ATGTCCGATCCTGCTGAAGTCCCCACAGCCAGCCCCTTGCTGGAAACCGTCGGGCTCGCCTGCGAGCGCGACTGGCGCATGCTGTTCGAGCGCCTCGACCTGCGCCTGGCCGCCGGCGAGATGTTGCAGGTGGTGGGTCCCAACGGCAGCGGCAAGACCAGCCTGCTGCGCCTGCTGTCCGGACTGATGCAGCCGACCGCCGGGGAAGTCCGCCTGAACGGCCGGCCGCTCGCCGAACAGCGCGGCGAACTGGCCCGCAGCCTGTTGTGGATCGGCCACGCCGCGGGAATCAAGGGCCTGCTCAGCGCCGAGGAGAACCTCACCTGGCTCTGCGCGCTGCACCAGCCGGCCAGCCGCGAGGCGATCTGGCAGGCCCTGGCCGACGTCGGCCTGCGTGGCTTCGAGGACGTTCCCTGTCACACCCTTTCCGCCGGCCAGCAACGCCGCGTGGCGCTGGCCCGCCTGTACCTGGACGCACCGCCCTTGTGGATCCTCGATGAACCCTTCACCGCCCTCGACAAACAGGGGGTGGCGCAACTGGAAACGCACCTGGCCGGGCATTGCCAGCGCGGCGGGATGGTGGTGCTGACCACCCACCACAGCCTGCAGCAGGTGCCCGCCGGCTACCGCGAGCTGGACCTTGGTGCGCTCAAGGCGGCCAGCGGCGCGACGGTCGAGCCGGCGCTGGGCGACCCGGCATGA |
| Protein Properties |
| Protein Residues: |
233 |
| Protein Molecular Weight: |
25 kDa |
| Protein Theoretical pI: |
5.88 |
| Hydropathicity (GRAVY score): |
-0.009 |
| Charge at pH 7 (predicted): |
-4.44 |
| Protein Sequence: |
>PA1475
MSDPAEVPTASPLLETVGLACERDWRMLFERLDLRLAAGEMLQVVGPNGSGKTSLLRLLSGLMQPTAGEVRLNGRPLAEQRGELARSLLWIGHAAGIKGLLSAEENLTWLCALHQPASREAIWQALADVGLRGFEDVPCHTLSAGQQRRVALARLYLDAPPLWILDEPFTALDKQGVAQLETHLAGHCQRGGMVVLTTHHSLQQVPAGYRELDLGALKAASGATVEPALGDPA |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA1475 and its homologs
|