Identification |
Name: |
Deoxyuridine 5'-triphosphate nucleotidohydrolase |
Synonyms: |
- dUTPase
- dUTP pyrophosphatase
|
Gene Name: |
dut |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in hydrolase activity |
Specific Function: |
This enzyme is involved in nucleotide metabolism:it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA |
Cellular Location: |
Cytoplasmic |
KEGG Pathways: |
|
KEGG Reactions: |
|
SMPDB Reactions: |
|
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
catalytic activity | dUTP diphosphatase activity | hydrolase activity | hydrolase activity, acting on acid anhydrides | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | nucleoside-triphosphate diphosphatase activity | pyrophosphatase activity | Process |
---|
cellular nitrogen compound metabolic process | dUTP metabolic process | metabolic process | nitrogen compound metabolic process | nucleobase, nucleoside and nucleotide metabolic process | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | nucleoside phosphate metabolic process | nucleotide metabolic process | pyrimidine deoxyribonucleoside triphosphate metabolic process | pyrimidine nucleoside triphosphate metabolic process | pyrimidine nucleotide metabolic process |
|
Gene Properties |
Locus tag: |
PA5321 |
Strand: |
+ |
Entrez Gene ID: |
879405 |
Accession: |
NP_254008.1 |
GI: |
15600514 |
Sequence start: |
5990676 |
Sequence End: |
5991131 |
Sequence Length: |
455 |
Gene Sequence: |
>PA5321
ATGCACTCTCTCCAAGCCAAGATCCTCGACCCCCGCCTGGGCTCCGACTTCCCGCTCCCGCAGTACGCCACGCCGGGCTCGGCCGGCCTGGACCTGCGCGCCATGCTCAAGGAAGACAGCGTCCTCGGCCCGGGCCAGACCCTGCTGATTCCCACCGGCCTGTCCATCTACATCGCCGATCCCGGCCTCGCCGCCCTGGTCCTGCCGCGCTCCGGCCTGGGGCACAAGCACGGCATCGTGCTGGGCAACCTGGTCGGCCTGATCGACTCGGACTACCAGGGCGAGCTGATGGTGTCGTGCTGGAACCGCGGCGAGTCGCCGTTCACCATCGCCGTCGGCGAGCGCATCGCGCAGTTGGTACTGGTGCCGGTGGTGCAGGCGCATTTCGAGCTGGTCGAAGCGTTCGACGAAAGCCAGCGCGGCGCCGGCGGCTTCGGCCATTCCGGCAGCCACTGA |
Protein Properties |
Protein Residues: |
151 |
Protein Molecular Weight: |
15.9 kDa |
Protein Theoretical pI: |
5.47 |
Hydropathicity (GRAVY score): |
0.175 |
Charge at pH 7 (predicted): |
-4.6 |
Protein Sequence: |
>PA5321
MHSLQAKILDPRLGSDFPLPQYATPGSAGLDLRAMLKEDSVLGPGQTLLIPTGLSIYIADPGLAALVLPRSGLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRGESPFTIAVGERIAQLVLVPVVQAHFELVEAFDESQRGAGGFGHSGSH |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA5321 and its homologs
|