Identification |
Name: |
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
Synonyms: |
- 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
- PPPK
- 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
- HPPK
|
Gene Name: |
folK |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity |
Specific Function: |
ATP + 2-amino-4-hydroxy-6-hydroxymethyl-7,8- dihydropteridine = AMP + (2-amino-4-hydroxy-7,8-dihydropteridin-6- yl)methyl diphosphate |
Cellular Location: |
Not Available |
KEGG Pathways: |
|
KEGG Reactions: |
Not Available |
SMPDB Reactions: |
|
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
Not Available |
Transports: |
Not Available |
Metabolites: |
PAMDB ID | Name | View |
---|
PAMDB001590 | 6-Hydroxymethyl dihydropterin | MetaboCard | PAMDB001591 | 6-Hydroxymethyl-dihydropterin pyrophosphate | MetaboCard | PAMDB000014 | Adenosine monophosphate | MetaboCard | PAMDB000148 | Adenosine triphosphate | MetaboCard | PAMDB001633 | Hydrogen ion | MetaboCard |
|
GO Classification: |
Function |
---|
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity | catalytic activity | diphosphotransferase activity | transferase activity | transferase activity, transferring phosphorus-containing groups | Process |
---|
cellular aromatic compound metabolic process | cellular metabolic process | folic acid and derivative biosynthetic process | folic acid and derivative metabolic process | metabolic process |
|
Gene Properties |
Locus tag: |
PA4728 |
Strand: |
+ |
Entrez Gene ID: |
881616 |
Accession: |
NP_253416.1 |
GI: |
15599922 |
Sequence start: |
5310726 |
Sequence End: |
5311214 |
Sequence Length: |
488 |
Gene Sequence: |
>PA4728
ATGATCCAGCGCGTCTACGTGGCGCTGGGCAGCAACCTGGCCGAACCGCGCGAGCAGATCCAGGCTGCCCTCGATGCCTTCGAGCGGCTTCCCGAGACCCGCCTGGTCGCCGTCTCGCCGCTCTACATCAGCGACCCGCTCGGCCCCGCCGACCAGCCGCGCTTCGTCAACGGCGTGGCGGCCCTCGACACCAACCTGGCGCCGCTCGACCTGCTCGACGCCCTGCAGGCCATCGAACTGGAACAGGGGCGCGTCCGCGACCTGCGCTGGGGTCCGCGCACGCTCGACCTGGACATCCTGCTGTTCGGCGAACAATTGCTCGACCTGCCGCGCCTGAAGGTGCCGCACTACCACATGCAGGCGCGCGCTTTCGTGCTCTATCCCCTCGCCGATCTCGCCCCCGACCTGCGCCTGCCCGATGGCCGCCACCTGCCGGAGCTGCTCGCGGCCTGTCCGTTCGAGGGCATCGAACGCCTTCCGGGCGCCTGA |
Protein Properties |
Protein Residues: |
162 |
Protein Molecular Weight: |
18 kDa |
Protein Theoretical pI: |
4.56 |
Hydropathicity (GRAVY score): |
0.035 |
Charge at pH 7 (predicted): |
-7.31 |
Protein Sequence: |
>PA4728
MIQRVYVALGSNLAEPREQIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVAALDTNLAPLDLLDALQAIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQARAFVLYPLADLAPDLRLPDGRHLPELLAACPFEGIERLPGA |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA4728 and its homologs
|