| Identification |
| Name: |
Nitrate reductase molybdenum cofactor assembly chaperone NarJ |
| Synonyms: |
- Redox enzyme maturation protein NarJ
|
| Gene Name: |
narJ |
| Enzyme Class: |
Not Available |
| Biological Properties |
| General Function: |
Involved in unfolded protein binding |
| Specific Function: |
Chaperone required for proper molybdenum cofactor insertion and final assembly of the membrane-bound respiratory nitrate reductase 1. Required for the insertion of the molybdenum into the apo-NarG subunit, maybe by keeping NarG in an appropriate competent-open conformation for the molybdenum cofactor insertion to occur. NarJ maintains the apoNarGH complex in a soluble state. Upon insertion of the molybdenum cofactor, NarJ seems to dissociate from the activated soluble NarGH complex, before its association with the NarI subunit on the membrane |
| Cellular Location: |
Cytoplasm |
| KEGG Pathways: |
|
| KEGG Reactions: |
|
 | + | Acceptor | + |  | + | Acceptor | ↔ |  | + | Reduced acceptor | + | Reduced acceptor |
| | |
2 Ferricytochrome c | + | | + | | ↔ | | + | 2 Ferrocytochrome c | + | 2  |
| |
|
| SMPDB Reactions: |
|
Nitrate | + | cytochrome c nitrite reductase | + | | ↔ | Nitrite | + | cytochrome c nitrite reductase | + | | + | |
| | | | |
| + | 2 | + | "a menaquinol" | → | | + | | + | "a menaquinone" |
| |
|
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Function |
|---|
| binding | | protein binding | | unfolded protein binding | | Process |
|---|
| cellular component assembly | | cellular component organization | | cellular component organization or biogenesis | | cellular protein complex assembly | | chaperone-mediated protein complex assembly | | macromolecular complex assembly | | protein complex assembly |
|
| Gene Properties |
| Locus tag: |
PA3873 |
| Strand: |
- |
| Entrez Gene ID: |
879782 |
| Accession: |
NP_252562.1 |
| GI: |
15599068 |
| Sequence start: |
4335962 |
| Sequence End: |
4336702 |
| Sequence Length: |
740 |
| Gene Sequence: |
>PA3873
ATGAACGATCACAGCCAACTGTTCCGCCTGCTCGCCCTGCTACTCGACTATCCACGCGCCGAGCTGCGCGAGGAGAGCCTCGGCCTGCATGCGCTGATCCGCACCTGCGAACTGCCGGAAGCGCTGCGCGACGGCCTCGCGGCGCTGCTCAACGAGCTCTGCCAGGGCGACCTGCTGGACGTCCAGGCGCGCTACGACGGTCTCTTCGAGCGCGGCCGCTCGGTCTCGCTGCTGCTCTTCGAGCACGTCCACGGCGAGAGCCGCGACCGTGGCCAGGCGATGGTCGACCTGCTCGACCGCTATACCGGGGCCGGCCTGCAGATCGACGTACCGGAGCTGCCGGACTACCTGCCGCTGTACCTCGAATACCTGTCGCTGCTGCCGTTCGCGGCGGCCAGCGAAGGGCTCGCCGAAGTGGCGCACATCCTCGGCCTGCTGGCGCTGCGCCTGGAGGAACGCGGCAGCGCCTACGCGGCGATTTTCGAGGCGTTGCTGGAACTCGGCGGCGAGCGCCCGGACCTCGGCGCGTTGCGTCGCGACCAGGCCCAGGAACAGCGCGACGACAGCCTGGAGGCCATCGACCGGGCCTGGGAGGAAACCCCGGTGAGCTTCACCGACCCCGCCGGCGGTTGCCCGTCGAGCAGCGGCCGCCGTCCAACGGCGTCCACCGAACAACCATTGCAATGGGTCGCCCAGCCGGTACCGCAGATGCAGTATCGAGCGGCCCGCGAAGGAGTCTGA |
| Protein Properties |
| Protein Residues: |
246 |
| Protein Molecular Weight: |
27.3 kDa |
| Protein Theoretical pI: |
4.31 |
| Hydropathicity (GRAVY score): |
-0.214 |
| Charge at pH 7 (predicted): |
-17.88 |
| Protein Sequence: |
>PA3873
MNDHSQLFRLLALLLDYPRAELREESLGLHALIRTCELPEALRDGLAALLNELCQGDLLDVQARYDGLFERGRSVSLLLFEHVHGESRDRGQAMVDLLDRYTGAGLQIDVPELPDYLPLYLEYLSLLPFAAASEGLAEVAHILGLLALRLEERGSAYAAIFEALLELGGERPDLGALRRDQAQEQRDDSLEAIDRAWEETPVSFTDPAGGCPSSSGRRPTASTEQPLQWVAQPVPQMQYRAAREGV |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA3873 and its homologs
|
