Identification |
Name: |
6-carboxy-5,6,7,8-tetrahydropterin synthase |
Synonyms: |
- CPH4 synthase
- Queuosine biosynthesis protein queD
|
Gene Name: |
queD |
Enzyme Class: |
|
Biological Properties |
General Function: |
Coenzyme transport and metabolism |
Specific Function: |
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde. Can also convert 6-pyruvoyltetrahydropterin (PPH4) and sepiapterin to CPH4; these 2 compounds are probably intermediates in the reaction from H2NTP |
Cellular Location: |
Not Available |
KEGG Pathways: |
|
KEGG Reactions: |
|
SMPDB Reactions: |
|
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
6-pyruvoyltetrahydropterin synthase activity | binding | carbon-oxygen lyase activity | carbon-oxygen lyase activity, acting on phosphates | catalytic activity | cation binding | ion binding | lyase activity | metal ion binding | Process |
---|
biosynthetic process | cellular biosynthetic process | heterocycle biosynthetic process | metabolic process | pteridine and derivative biosynthetic process | tetrahydrobiopterin biosynthetic process |
|
Gene Properties |
Locus tag: |
PA2666 |
Strand: |
+ |
Entrez Gene ID: |
882375 |
Accession: |
NP_251356.1 |
GI: |
15597862 |
Sequence start: |
3015582 |
Sequence End: |
3015938 |
Sequence Length: |
356 |
Gene Sequence: |
>PA2666
GTGGAACTCTTCAAAGAATTCACCTTCGAATCCGCCCATCGCCTGCCCCACGTCCCCGAAGGCCACAAATGCGGGCGCCTGCACGGCCACTCGTTCCGTGTCGCCATCCACATCGAAGGCGAGGTCGATCCGCATACCGGCTGGATCCGCGACTTCGCGGAAATCAAGGCGATCTTCAAGCCGATCTACGAGCAACTCGACCACAATTATCTGAACGATATTCCAGGCCTGGAAAACCCCACCAGCGAAAACCTCTGCCGCTGGATCTGGCAACAACTCAAGCCGCTGTTGCCGGAACTCTCCAAGGTCCGCGTCCACGAAACTTGCACCAGCGGTTGCGAATATCGGGGCGATTGA |
Protein Properties |
Protein Residues: |
118 |
Protein Molecular Weight: |
13.8 kDa |
Protein Theoretical pI: |
6.41 |
Hydropathicity (GRAVY score): |
-0.545 |
Charge at pH 7 (predicted): |
-2.97 |
Protein Sequence: |
>PA2666
MELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKPIYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRGD |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA2666 and its homologs
|