| Identification |
| Name: |
Potassium-transporting ATPase C chain |
| Synonyms: |
- ATP phosphohydrolase [potassium-transporting] C chain
- Potassium-binding and translocating subunit C
- Potassium-translocating ATPase C chain
|
| Gene Name: |
kdpC |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in potassium-transporting ATPase activity |
| Specific Function: |
One of the components of the high-affinity ATP-driven potassium transport (or KDP) system, which catalyzes the hydrolysis of ATP coupled with the exchange of hydrogen and potassium ions. The C subunit may be involved in assembly of the KDP complex |
| Cellular Location: |
Cell inner membrane; Single-pass membrane protein (Probable) |
| KEGG Pathways: |
|
| KEGG Reactions: |
Not Available |
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Component |
|---|
| cell part | | membrane | | Function |
|---|
| cation transmembrane transporter activity | | inorganic cation transmembrane transporter activity | | ion transmembrane transporter activity | | monovalent inorganic cation transmembrane transporter activity | | potassium ion transmembrane transporter activity | | potassium-transporting ATPase activity | | substrate-specific transmembrane transporter activity | | transmembrane transporter activity | | transporter activity | | Process |
|---|
| cation transport | | establishment of localization | | ion transport | | monovalent inorganic cation transport | | potassium ion transport | | transport |
|
| Gene Properties |
| Locus tag: |
PA1635 |
| Strand: |
+ |
| Entrez Gene ID: |
883003 |
| Accession: |
NP_250326.1 |
| GI: |
15596832 |
| Sequence start: |
1779877 |
| Sequence End: |
1780428 |
| Sequence Length: |
551 |
| Gene Sequence: |
>PA1635
ATGTTCAAGCAACTCCGTCCGGCACTGGCGTCACTGCTGGTGCTGAGCCTGGTCACCGGCGTGGCCTATCCGCTGCTGGTCACCGGTATCGCCCAACTGGCGTTCCCCGAGCAGGCCAATGGCAGCCTGCTGCGCGACGCCGAGGGCAAGGTGCTCGGCTCGCGGCTGATCGCGCAGAAGTTCGACGGCGAGGAGTGGTTCCATTCGCGGCCTTCGGCGGGCGACTACGCCACCGTTTCCAGTGCCGCGAGCAACCTGGCGCCGAGCAACCCGGCACTGGCCGAGCGCATCGCCAGGGACGCCGCCCAGGAGCGTATCGCCGACCAGGGGCCGGTGCCGCTGGCGCTGGTCACTACCTCCGGTAGCGGACTCGATCCGCAGCTGCCGCCGCAGGCCGCGCGTTACCAGGCGCTGCGGGTGGCCACGGCGCGCGGGCTGCCGCTGCGGCTGGTGGAAGACCTGGTGGAAAGCCACACCGAGCGGCCGCTGGTGGGGCCGGCGGTGGTCAACGTGCTGGCGCTGAACATGGCGCTGGCGGGGTTGAAGCGCTAG |
| Protein Properties |
| Protein Residues: |
183 |
| Protein Molecular Weight: |
19.3 kDa |
| Protein Theoretical pI: |
9.01 |
| Hydropathicity (GRAVY score): |
0.138 |
| Charge at pH 7 (predicted): |
1.47 |
| Protein Sequence: |
>PA1635
MFKQLRPALASLLVLSLVTGVAYPLLVTGIAQLAFPEQANGSLLRDAEGKVLGSRLIAQKFDGEEWFHSRPSAGDYATVSSAASNLAPSNPALAERIARDAAQERIADQGPVPLALVTTSGSGLDPQLPPQAARYQALRVATARGLPLRLVEDLVESHTERPLVGPAVVNVLALNMALAGLKR |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA1635 and its homologs
|