Identification |
Name: |
Potassium-transporting ATPase C chain |
Synonyms: |
- ATP phosphohydrolase [potassium-transporting] C chain
- Potassium-binding and translocating subunit C
- Potassium-translocating ATPase C chain
|
Gene Name: |
kdpC |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in potassium-transporting ATPase activity |
Specific Function: |
One of the components of the high-affinity ATP-driven potassium transport (or KDP) system, which catalyzes the hydrolysis of ATP coupled with the exchange of hydrogen and potassium ions. The C subunit may be involved in assembly of the KDP complex |
Cellular Location: |
Cell inner membrane; Single-pass membrane protein (Probable) |
KEGG Pathways: |
|
KEGG Reactions: |
Not Available |
SMPDB Reactions: |
Not Available |
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Component |
---|
cell part | membrane | Function |
---|
cation transmembrane transporter activity | inorganic cation transmembrane transporter activity | ion transmembrane transporter activity | monovalent inorganic cation transmembrane transporter activity | potassium ion transmembrane transporter activity | potassium-transporting ATPase activity | substrate-specific transmembrane transporter activity | transmembrane transporter activity | transporter activity | Process |
---|
cation transport | establishment of localization | ion transport | monovalent inorganic cation transport | potassium ion transport | transport |
|
Gene Properties |
Locus tag: |
PA1635 |
Strand: |
+ |
Entrez Gene ID: |
883003 |
Accession: |
NP_250326.1 |
GI: |
15596832 |
Sequence start: |
1779877 |
Sequence End: |
1780428 |
Sequence Length: |
551 |
Gene Sequence: |
>PA1635
ATGTTCAAGCAACTCCGTCCGGCACTGGCGTCACTGCTGGTGCTGAGCCTGGTCACCGGCGTGGCCTATCCGCTGCTGGTCACCGGTATCGCCCAACTGGCGTTCCCCGAGCAGGCCAATGGCAGCCTGCTGCGCGACGCCGAGGGCAAGGTGCTCGGCTCGCGGCTGATCGCGCAGAAGTTCGACGGCGAGGAGTGGTTCCATTCGCGGCCTTCGGCGGGCGACTACGCCACCGTTTCCAGTGCCGCGAGCAACCTGGCGCCGAGCAACCCGGCACTGGCCGAGCGCATCGCCAGGGACGCCGCCCAGGAGCGTATCGCCGACCAGGGGCCGGTGCCGCTGGCGCTGGTCACTACCTCCGGTAGCGGACTCGATCCGCAGCTGCCGCCGCAGGCCGCGCGTTACCAGGCGCTGCGGGTGGCCACGGCGCGCGGGCTGCCGCTGCGGCTGGTGGAAGACCTGGTGGAAAGCCACACCGAGCGGCCGCTGGTGGGGCCGGCGGTGGTCAACGTGCTGGCGCTGAACATGGCGCTGGCGGGGTTGAAGCGCTAG |
Protein Properties |
Protein Residues: |
183 |
Protein Molecular Weight: |
19.3 kDa |
Protein Theoretical pI: |
9.01 |
Hydropathicity (GRAVY score): |
0.138 |
Charge at pH 7 (predicted): |
1.47 |
Protein Sequence: |
>PA1635
MFKQLRPALASLLVLSLVTGVAYPLLVTGIAQLAFPEQANGSLLRDAEGKVLGSRLIAQKFDGEEWFHSRPSAGDYATVSSAASNLAPSNPALAERIARDAAQERIADQGPVPLALVTTSGSGLDPQLPPQAARYQALRVATARGLPLRLVEDLVESHTERPLVGPAVVNVLALNMALAGLKR |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA1635 and its homologs
|