Identification |
Name: |
Riboflavin synthase alpha chain |
Synonyms: |
Not Available |
Gene Name: |
ribE |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in riboflavin synthase activity |
Specific Function: |
Riboflavin synthase is a bifunctional enzyme complex catalyzing the formation of riboflavin from 5-amino-6-(1'-D)- ribityl-amino-2,4(1H,3H)-pyrimidinedione and L-3,4-dihydrohy-2- butanone-4-phosphate via 6,7-dimethyl-8-lumazine. The alpha subunit catalyzes the dismutation of 6,7-dimethyl-8-lumazine to riboflavin and 5-amino-6-(1'-D)-ribityl-amino-2,4(1H,3H)- pyrimidinedione |
Cellular Location: |
Not Available |
KEGG Pathways: |
|
KEGG Reactions: |
|
SMPDB Reactions: |
|
 | + |  | → |  | + |  | + |  | + | 6,7-Dimethyl-8-(1-D-ribityl)lumazine | + |  |
| | |
6,7-Dimethyl-8-(1-D-ribityl)lumazine | + |  | + |  | → | Riboflavin | + |  | + |  |
| | | | | |
|
PseudoCyc/BioCyc Reactions: |
| | | | | | | 1-deoxy-L-glycero-tetrulose 4-phosphate + 5-amino-6-(D-ribitylamino)uracil → 6,7-dimethyl-8-(1-D-ribityl)lumazine + phosphate + H + + 2 H 2O ReactionCard |
|
Complex Reactions: |
Not Available |
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
catalytic activity | riboflavin synthase activity | transferase activity | transferase activity, transferring alkyl or aryl (other than methyl) groups | Process |
---|
metabolic process | nitrogen compound metabolic process | riboflavin biosynthetic process | riboflavin metabolic process |
|
Gene Properties |
Locus tag: |
PA4053 |
Strand: |
- |
Entrez Gene ID: |
879081 |
Accession: |
NP_252742.1 |
GI: |
15599248 |
Sequence start: |
4534116 |
Sequence End: |
4534592 |
Sequence Length: |
476 |
Gene Sequence: |
>PA4053
ATGACCCTGAAGACCATCGAAGGTACCTTCATTGCCCCCAAAGGCCGCTACGCCCTGGTGGTCGGCCGCTTCAACAGCTTCGTCGTGGAAAGCCTGGTCAGCGGCGCCGTCGACGCCCTGGTCCGCCACGGCGTGGCTGAAAGCGAGATCACCATCATCCGCGCCCCGGGTGCCTTCGAGATCCCGCTGGTGACCCAGAAGGTCGCCCAGCAAGGCGGCTTCGACGCCATCATCGCCCTCGGCGCGGTGATCCGTGGCGGCACCCCGCACTTCGAATACGTGGCTGGCGAGTGCACCAAGGGCCTGGCCCAGGTGTCCCTGCAGTTCGGCATCCCGGTCGCCTTCGGCGTCCTCACCGTCGACTCCATCGAGCAGGCCATCGAGCGCTCCGGCACCAAGGCCGGCAACAAGGGCGCCGAAGCCGCGCTGTCGGCCCTGGAAATGGTCAGCCTGCTGGCGCAGTTGGAGGCCAAGTGA |
Protein Properties |
Protein Residues: |
158 |
Protein Molecular Weight: |
16.4 kDa |
Protein Theoretical pI: |
5.75 |
Hydropathicity (GRAVY score): |
0.449 |
Charge at pH 7 (predicted): |
-1.56 |
Protein Sequence: |
>PA4053
MTLKTIEGTFIAPKGRYALVVGRFNSFVVESLVSGAVDALVRHGVAESEITIIRAPGAFEIPLVTQKVAQQGGFDAIIALGAVIRGGTPHFEYVAGECTKGLAQVSLQFGIPVAFGVLTVDSIEQAIERSGTKAGNKGAEAALSALEMVSLLAQLEAK |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA4053 and its homologs
|