Identification |
Name: |
Molybdopterin synthase catalytic subunit |
Synonyms: |
- MPT synthase subunit 2
- Molybdenum cofactor biosynthesis protein E
- Molybdopterin-converting factor large subunit
- Molybdopterin-converting factor subunit 2
|
Gene Name: |
moaE |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in Mo-molybdopterin cofactor biosynthetic process |
Specific Function: |
Converts molybdopterin precursor Z to molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by moaD |
Cellular Location: |
Not Available |
KEGG Pathways: |
|
KEGG Reactions: |
|
| + | 2 Sulfur donor | ↔ | |
| |
|
SMPDB Reactions: |
|
| + | | + | thiocarboxylated small subunit of molybdopterin synthase | → | 4 | + | 2 thiocarboxylated small subunit of molybdopterin synthase | + | Molybdopterin | + | |
| |
|
PseudoCyc/BioCyc Reactions: |
|
| + | 2 Sulfur donor | ↔ | |
| | |
| + | | + | thiocarboxylated small subunit of molybdopterin synthase | → | 4 | + | 2 thiocarboxylated small subunit of molybdopterin synthase | + | Molybdopterin | + | |
| |
|
Complex Reactions: |
|
| + | | + | 2 MoaD Protein with thiocarboxylate | → | 5 | + | 2 MoaD Protein with carboxylate | + | |
| |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Process |
---|
cellular metabolic process | coenzyme biosynthetic process | coenzyme metabolic process | cofactor metabolic process | metabolic process | Mo-molybdopterin cofactor biosynthetic process |
|
Gene Properties |
Locus tag: |
PA3916 |
Strand: |
- |
Entrez Gene ID: |
878985 |
Accession: |
NP_252605.1 |
GI: |
15599111 |
Sequence start: |
4385900 |
Sequence End: |
4386352 |
Sequence Length: |
452 |
Gene Sequence: |
>PA3916
ATGGCCATCCGCGTCCAGCAGGCCGCTTTCGATCCGGGGCAGGAGCTTAACGCCCTGCATGCGCAGAACGTCGGCATCGGCGCGGTGGTCGGCTTCGTCGGCTACGTGCGCGACTTCAACGACGGTCGCGAGGTCGGCGGGATGTTCCTCGAACATTATCCGGGCATGACCGAGAAGGCCCTCGGCAAGATCGCCGCCGAGGCCGGGCAGCGCTGGCCGCTGCTGCGCCTGGAGATCCTCCACCGCATCGGCCGCCTGGAGCCGGGCGAGCCGATCGTCTTCGTCGGTTGCGCCAGCGCCCACCGGCAGGCGGCGTTCGACGCCTGCAACTTCGTCATGGACTACCTGAAGACCCGCGCGCCGTTCTGGAAGAAGGAAGACACCGCCGAAGGCCCGCGCTGGGTCGAAGGCCGCTGCAGCGACCAGGCCGCCGCGCAGCGCTGGGAGGAGTGA |
Protein Properties |
Protein Residues: |
150 |
Protein Molecular Weight: |
16.7 kDa |
Protein Theoretical pI: |
6.11 |
Hydropathicity (GRAVY score): |
-0.283 |
Charge at pH 7 (predicted): |
-2.14 |
Protein Sequence: |
>PA3916
MAIRVQQAAFDPGQELNALHAQNVGIGAVVGFVGYVRDFNDGREVGGMFLEHYPGMTEKALGKIAAEAGQRWPLLRLEILHRIGRLEPGEPIVFVGCASAHRQAAFDACNFVMDYLKTRAPFWKKEDTAEGPRWVEGRCSDQAAAQRWEE |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA3916 and its homologs
|