Identification
Name: Molybdopterin synthase catalytic subunit
Synonyms:
  • MPT synthase subunit 2
  • Molybdenum cofactor biosynthesis protein E
  • Molybdopterin-converting factor large subunit
  • Molybdopterin-converting factor subunit 2
Gene Name: moaE
Enzyme Class:
Biological Properties
General Function: Involved in Mo-molybdopterin cofactor biosynthetic process
Specific Function: Converts molybdopterin precursor Z to molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by moaD
Cellular Location: Not Available
KEGG Pathways:
KEGG Reactions:
Thumb+2 Sulfur donorThumb
SMPDB Reactions:
Thumb+Thumb+thiocarboxylated small subunit of molybdopterin synthase4 Thumb+2 thiocarboxylated small subunit of molybdopterin synthase+Molybdopterin+Thumb
Cyclic pyranopterin monophosphate + Water + thiocarboxylated small subunit of molybdopterin synthase → 4 Hydrogen ion + 2 thiocarboxylated small subunit of molybdopterin synthase + Molybdopterin + Molybdopterin
ReactionCard
PseudoCyc/BioCyc Reactions:
Thumb+2 Sulfur donorThumb
Thumb+Thumb+thiocarboxylated small subunit of molybdopterin synthase4 Thumb+2 thiocarboxylated small subunit of molybdopterin synthase+Molybdopterin+Thumb
Cyclic pyranopterin monophosphate + Water + thiocarboxylated small subunit of molybdopterin synthase → 4 Hydrogen ion + 2 thiocarboxylated small subunit of molybdopterin synthase + Molybdopterin + Molybdopterin
ReactionCard
Complex Reactions:
Thumb+Thumb+2 MoaD Protein with thiocarboxylate5 Thumb+2 MoaD Protein with carboxylate+Thumb
Cyclic pyranopterin monophosphate + Copper + 2 MoaD Protein with thiocarboxylate → 5 Hydrogen ion + 2 MoaD Protein with carboxylate + Molybdopterin
ReactionCard
Transports: Not Available
Metabolites:
PAMDB IDNameView
PAMDB000166CopperMetaboCard
PAMDB001401Cyclic pyranopterin monophosphateMetaboCard
PAMDB001633Hydrogen ionMetaboCard
PAMDB000446MolybdopterinMetaboCard
PAMDB000142WaterMetaboCard
GO Classification:
Process
cellular metabolic process
coenzyme biosynthetic process
coenzyme metabolic process
cofactor metabolic process
metabolic process
Mo-molybdopterin cofactor biosynthetic process
Gene Properties
Locus tag: PA3916
Strand: -
Entrez Gene ID: 878985
Accession: NP_252605.1
GI: 15599111
Sequence start: 4385900
Sequence End: 4386352
Sequence Length: 452
Gene Sequence:
>PA3916
ATGGCCATCCGCGTCCAGCAGGCCGCTTTCGATCCGGGGCAGGAGCTTAACGCCCTGCATGCGCAGAACGTCGGCATCGGCGCGGTGGTCGGCTTCGTCGGCTACGTGCGCGACTTCAACGACGGTCGCGAGGTCGGCGGGATGTTCCTCGAACATTATCCGGGCATGACCGAGAAGGCCCTCGGCAAGATCGCCGCCGAGGCCGGGCAGCGCTGGCCGCTGCTGCGCCTGGAGATCCTCCACCGCATCGGCCGCCTGGAGCCGGGCGAGCCGATCGTCTTCGTCGGTTGCGCCAGCGCCCACCGGCAGGCGGCGTTCGACGCCTGCAACTTCGTCATGGACTACCTGAAGACCCGCGCGCCGTTCTGGAAGAAGGAAGACACCGCCGAAGGCCCGCGCTGGGTCGAAGGCCGCTGCAGCGACCAGGCCGCCGCGCAGCGCTGGGAGGAGTGA
Protein Properties
Protein Residues: 150
Protein Molecular Weight: 16.7 kDa
Protein Theoretical pI: 6.11
Hydropathicity (GRAVY score): -0.283
Charge at pH 7 (predicted): -2.14
Protein Sequence:
>PA3916
MAIRVQQAAFDPGQELNALHAQNVGIGAVVGFVGYVRDFNDGREVGGMFLEHYPGMTEKALGKIAAEAGQRWPLLRLEILHRIGRLEPGEPIVFVGCASAHRQAAFDACNFVMDYLKTRAPFWKKEDTAEGPRWVEGRCSDQAAAQRWEE
References
External Links:
Resource Link
Genome ID: PA3916
Entrez Gene ID: 878985
NCBI Protein ID: 15599111
General Reference: PaperBLAST - Find papers about PA3916 and its homologs