Identification |
Name: |
Carbonic anhydrase 1 |
Synonyms: |
|
Gene Name: |
cynT |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in carbonate dehydratase activity |
Specific Function: |
Reversible hydration of carbon dioxide. Carbon dioxide formed in the bicarbonate-dependent decomposition of cyanate by cyanase (cynS) diffuses out of the cell faster than it would be hydrated to bicarbonate, so the apparent function of this enzyme is to catalyze the hydration of carbon dioxide and thus prevent depletion of cellular bicarbonate |
Cellular Location: |
Not Available |
KEGG Pathways: |
|
KEGG Reactions: |
|
SMPDB Reactions: |
|
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
binding | carbon-oxygen lyase activity | carbonate dehydratase activity | catalytic activity | cation binding | hydro-lyase activity | ion binding | lyase activity | metal ion binding | transition metal ion binding | zinc ion binding | Process |
---|
carbon utilization |
|
Gene Properties |
Locus tag: |
PA2053 |
Strand: |
- |
Entrez Gene ID: |
878074 |
Accession: |
NP_250743.1 |
GI: |
15597249 |
Sequence start: |
2246496 |
Sequence End: |
2247158 |
Sequence Length: |
662 |
Gene Sequence: |
>PA2053
ATGCGTGACATCATCGACGGCTTTCTCCGCTTCCAGCGCGACGCCTACCCGGCGCGCTCGCAACTGTTCAAGTCCCTGGCCACCCGGCAAGCCCCCAAGGCACTGTTCATCGCCTGCTCGGACAGCCGGGTGGTCCCCGAACTGCTGACCCAGCGCGAGCCCGGCGAACTCTTCGTGATCCGTAATGCCGGCAACATCGTCCCCGGCTACGGGCCGCAGCCCGGCGGGGTCAGCGCCTCGGTGGAATACGCGGTGGCGGTGCTCGGGGTCGGCGACATCGTGGTCTGCGGCCACTCGGACTGCGGCGCGATGGGCGCCATCGCTTCCTGCGCCTGTCTCGACCAGCTGCCGGCGGTGGCCGGCTGGTTGCACCACGCCGAGGCCGCACGGGCGATGAACAGCGCCCACGAACACGCCTCCGAGGCGGCGCGGCTGGACGCCCTGGTGCGGCACAACGTGATCGCCCAACTGGCCAACCTGCGCACCCACCCCTGCGTCGCCCGCGCCCTGGAGCAGGGTCGGCTGAACCTGCACGGCTGGGTCTACGACATCGAAAGCGGCCGCATCGACGCCCTCGACGGCGCCAGCCGGCGCTTCGTCTCCCTCGCCGAGCATCCCGAAGTGCGCGCGGTAGGCGGCGAACCCGGGCAGGCGGTCGCCTGA |
Protein Properties |
Protein Residues: |
220 |
Protein Molecular Weight: |
23.4 kDa |
Protein Theoretical pI: |
6.78 |
Hydropathicity (GRAVY score): |
0.045 |
Charge at pH 7 (predicted): |
-1.03 |
Protein Sequence: |
>PA2053
MRDIIDGFLRFQRDAYPARSQLFKSLATRQAPKALFIACSDSRVVPELLTQREPGELFVIRNAGNIVPGYGPQPGGVSASVEYAVAVLGVGDIVVCGHSDCGAMGAIASCACLDQLPAVAGWLHHAEAARAMNSAHEHASEAARLDALVRHNVIAQLANLRTHPCVARALEQGRLNLHGWVYDIESGRIDALDGASRRFVSLAEHPEVRAVGGEPGQAVA |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA2053 and its homologs
|