Identification |
Name: |
Cytochrome o ubiquinol oxidase subunit 3 |
Synonyms: |
- Cytochrome o ubiquinol oxidase subunit III
- Ubiquinol oxidase chain C
|
Gene Name: |
cyoC |
Enzyme Class: |
Not Available |
Biological Properties |
General Function: |
Involved in heme-copper terminal oxidase activity |
Specific Function: |
Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain of E.coli that predominates when cells are grown at high aeration |
Cellular Location: |
Cell inner membrane; Multi-pass membrane protein |
KEGG Pathways: |
- Oxidative phosphorylation PW000919
- succinate to cytochrome bo oxidase electron transfer PWY0-1329
- proline to cytochrome bo oxidase electron transfer PWY0-1544
- NADH to cytochrome bo oxidase electron transfer PWY0-1335
|
KEGG Reactions: |
Not Available |
SMPDB Reactions: |
|
PseudoCyc/BioCyc Reactions: |
| | | | | | |
| + | | + | Ubiquinols | → | | + | Ubiquinones | + | |
| |
|
Complex Reactions: |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Component |
---|
cell part | membrane | plasma membrane | Function |
---|
catalytic activity | cytochrome-c oxidase activity | heme-copper terminal oxidase activity | oxidoreductase activity | oxidoreductase activity, acting on diphenols and related substances as donors | oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor | Process |
---|
cellular metabolic process | electron transport chain | generation of precursor metabolites and energy | metabolic process | mitochondrial electron transport, cytochrome c to oxygen | oxidation reduction | respiratory electron transport chain |
|
Gene Properties |
Locus tag: |
PA1319 |
Strand: |
+ |
Entrez Gene ID: |
881595 |
Accession: |
NP_250010.1 |
GI: |
15596516 |
Sequence start: |
1431062 |
Sequence End: |
1431691 |
Sequence Length: |
629 |
Gene Sequence: |
>PA1319
ATGTCGACGGCAGTATTGAACAAGCATCTGGCCGACGCCCACGAAGTGGGCCACGACCACGATCATGCACACGATAGCGGCGGCAACACCGTATTCGGTTTCTGGCTCTACCTGATGACCGACTGCGTGCTGTTCGCCAGCGTCTTCGCCACCTACGCGGTGCTGGTTCACCACACCGCCGGCGGCCCCAGCGGCAAGGACATCTTCGAGCTGCCCTACGTGCTGGTGGAAACCGCCATCCTGCTGGTTTCCAGCTGCACCTACGGCCTGGCCATGCTCTCTGCGCACAAGGGCGCCAAGGGCCAGGCGATCGCCTGGCTCGGGGTCACCTTCCTGCTCGGCGCCGCGTTCATCGGGATGGAGATCAACGAGTTCCACCACCTGATCGCCGAAGGTTTCGGCCCGAGCCGCAGCGCCTTCCTGTCGTCCTTCTTCACCCTGGTCGGCATGCACGGCCTGCACGTCAGCGCCGGTCTGCTGTGGATGCTGGTGCTGATGGCGCAGATCTGGACCCGCGGCCTCACCGCGCAGAACAACACCCGGATGATGTGCCTGAGCCTGTTCTGGCACTTCCTCGACATCGTCTGGATCTGCGTCTTCACCGTCGTCTACCTGATGGGGGCCCTGTAA |
Protein Properties |
Protein Residues: |
209 |
Protein Molecular Weight: |
22.8 kDa |
Protein Theoretical pI: |
6.62 |
Hydropathicity (GRAVY score): |
0.695 |
Charge at pH 7 (predicted): |
-2.77 |
Protein Sequence: |
>PA1319
MSTAVLNKHLADAHEVGHDHDHAHDSGGNTVFGFWLYLMTDCVLFASVFATYAVLVHHTAGGPSGKDIFELPYVLVETAILLVSSCTYGLAMLSAHKGAKGQAIAWLGVTFLLGAAFIGMEINEFHHLIAEGFGPSRSAFLSSFFTLVGMHGLHVSAGLLWMLVLMAQIWTRGLTAQNNTRMMCLSLFWHFLDIVWICVFTVVYLMGAL |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA1319 and its homologs
|