Identification
Name: Spermidine export protein mdtJ
Synonyms: Not Available
Gene Name: mdtJ
Enzyme Class: Not Available
Biological Properties
General Function: Involved in spermidine transmembrane transporter activity
Specific Function: Catalyzes the excretion of spermidine. Can also confer resistance to deoxycholate and SDS
Cellular Location: Cell inner membrane; Multi-pass membrane protein
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports:
    Metabolites:
    PAMDB IDNameView
    PAMDB001633Hydrogen ionMetaboCard
    PAMDB000312SpermidineMetaboCard
    GO Classification:
    Component
    cell part
    integral to membrane
    intrinsic to membrane
    membrane part
    Gene Properties
    Locus tag: PA1541
    Strand: -
    Entrez Gene ID: 883058
    Accession: NP_250232.1
    GI: 15596738
    Sequence start: 1678584
    Sequence End: 1678952
    Sequence Length: 368
    Gene Sequence:
    >PA1541
    ATGCGTTCCTGGATCTATCTGTTACTGGCTATCGGCGCCGAAGTGATCGGCACCACCTCGATGAAACTGGCCGCCACCCACGCCCCTGTCGCAGGCATGCTGCTGATGTACGGGATGATCGGCCTGTCCTATTTCTTCCTCGCCCTGGCGGTCAAGCGTGTCCCCGTCGGAGTCGCCTACGCCCTTTGGGAAGGCATTGGCATCGTCCTGATCACGGCGGTCAGCGTCGCCTGGCTGGGCGAAAGCATCGGCCTGTACAAGGCCGTCGGCCTCGGCGTGATGATCGCCGGCATCCTGCTGATCAAGTCCGGCACCCGCAACGCCAGCGGCACGCCGGCGCAGTCCCGTGGGGAGGCCGTCACATGCTGA
    Protein Properties
    Protein Residues: 122
    Protein Molecular Weight: 12.7 kDa
    Protein Theoretical pI: 9.82
    Hydropathicity (GRAVY score): 0.994
    Charge at pH 7 (predicted): 4.19
    Protein Sequence:
    >PA1541
    MRSWIYLLLAIGAEVIGTTSMKLAATHAPVAGMLLMYGMIGLSYFFLALAVKRVPVGVAYALWEGIGIVLITAVSVAWLGESIGLYKAVGLGVMIAGILLIKSGTRNASGTPAQSRGEAVTC
    References
    External Links:
    Resource Link
    Genome ID: PA1541
    Entrez Gene ID: 883058
    NCBI Protein ID: 15596738
    General Reference: PaperBLAST - Find papers about PA1541 and its homologs