Identification |
Name: |
Peptide deformylase |
Synonyms: |
- PDF
- Polypeptide deformylase
|
Gene Name: |
def |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in iron ion binding |
Specific Function: |
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions |
Cellular Location: |
Cytoplasmic |
KEGG Pathways: |
Not Available |
KEGG Reactions: |
|
Formyl-L-methionyl peptide | + | ![Thumb](/molecules/PAMDB000142thumb.png) | ↔ | ![Thumb](/molecules/PAMDB000053thumb.png) | + | Methionyl peptide |
| |
|
SMPDB Reactions: |
Not Available |
PseudoCyc/BioCyc Reactions: |
|
![Thumb](/molecules/PAMDB000142thumb.png) | + | formyl-L-methionyl peptide | → | ![Thumb](/molecules/PAMDB001633thumb.png) | + | methionyl peptide | + | ![Thumb](/molecules/PAMDB000053thumb.png) |
| |
|
Complex Reactions: |
|
Formyl-L-methionyl peptide | + | ![Thumb](/molecules/PAMDB000142thumb.png) | → | ![Thumb](/molecules/PAMDB000053thumb.png) | + | methionyl peptide |
| |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Function |
---|
binding | catalytic activity | cation binding | hydrolase activity | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides | ion binding | iron ion binding | metal ion binding | peptide deformylase activity | transition metal ion binding | Process |
---|
biosynthetic process | cellular macromolecule biosynthetic process | macromolecule biosynthetic process | metabolic process | translation |
|
Gene Properties |
Locus tag: |
PA0019 |
Strand: |
- |
Entrez Gene ID: |
879306 |
Accession: |
NP_248709.1 |
GI: |
15595217 |
Sequence start: |
21067 |
Sequence End: |
21573 |
Sequence Length: |
506 |
Gene Sequence: |
>PA0019
ATGGCCATCCTGAACATTCTCGAATTCCCCGATCCGCGCCTGCGGACCATCGCCAAACCGGTGGAGGTGGTCGACGACGCGGTGCGCCAGCTGATCGACGACATGTTCGAAACCATGTACGAAGCCCCGGGCATCGGCCTCGCCGCGACCCAGGTGAACGTGCACAAGCGCATCGTGGTCATGGACCTCAGCGAAGACAAGTCCGAGCCGAGGGTATTCATCAACCCCGAGTTCGAACCGCTGACCGAGGATATGGACCAGTACCAGGAAGGCTGCCTGTCGGTACCCGGCTTCTACGAGAACGTGGACCGACCGCAGAAGGTCCGGATCAAGGCCCTCGACCGCGATGGCAACCCCTTCGAGGAAGTCGCCGAAGGCCTGCTGGCGGTATGCATCCAGCACGAATGCGACCACCTCAACGGCAAGCTGTTCGTCGACTACCTGTCCACCCTCAAGCGCGACCGCATCCGCAAGAAGCTGGAAAAGCAGCATCGACAGCAGGCGTGA |
Protein Properties |
Protein Residues: |
168 |
Protein Molecular Weight: |
19.4 kDa |
Protein Theoretical pI: |
4.73 |
Hydropathicity (GRAVY score): |
-0.441 |
Charge at pH 7 (predicted): |
-8.13 |
Protein Sequence: |
>PA0019
MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQQA |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA0019 and its homologs
|