Iron-binding protein iscA (PA3812)

Identification
Name: Iron-binding protein iscA
Synonyms:
  • Iron-sulfur cluster assembly protein
Gene Name: iscA
Enzyme Class: Not Available
Biological Properties
General Function: Involved in structural molecule activity
Specific Function: Is able to transfer iron-sulfur clusters to apo- ferredoxin. Multiple cycles of [2Fe2S] cluster formation and transfer are observed, suggesting that iscA acts catalytically. Recruits intracellular free iron so as to provide iron for the assembly of transient iron-sulfur cluster in iscU in the presence of iscS, L-cysteine and the thioredoxin reductase system trxA/trxB
Cellular Location: Not Available
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions:
    4 Thumb+IscU with bound [2Fe-2S] cluster → [2Fe-2S] iron-sulfur cluster+IscU scaffold protein
    4 Hydrogen ion + IscU with bound [2Fe-2S] cluster → [2Fe-2S] iron-sulfur cluster + IscU scaffold protein
    ReactionCard
    4 Thumb+IscU with bound [4Fe-4S] cluster → [4Fe-4S] iron-sulfur cluster+IscU scaffold protein
    4 Hydrogen ion + IscU with bound [4Fe-4S] cluster → [4Fe-4S] iron-sulfur cluster + IscU scaffold protein
    ReactionCard
    Transports: Not Available
    Metabolites:
    PAMDB IDNameView
    PAMDB001633Hydrogen ionMetaboCard
    GO Classification:
    Function
    binding
    cation binding
    ion binding
    iron ion binding
    iron-sulfur cluster binding
    metal cluster binding
    metal ion binding
    protein binding
    structural molecule activity
    transition metal ion binding
    Process
    biosynthetic process
    cellular biosynthetic process
    cofactor biosynthetic process
    iron-sulfur cluster assembly
    metabolic process
    metallo-sulfur cluster assembly
    Gene Properties
    Locus tag: PA3812
    Strand: -
    Entrez Gene ID: 879916
    Accession: NP_252501.1
    GI: 15599007
    Sequence start: 4270148
    Sequence End: 4270471
    Sequence Length: 323
    Gene Sequence: 
    >PA3812
ATGGCCATCAGCATGACCGAAGCCGCCGCCAAACACGTGCAGCGCTCCCTCGAGGGGCGCGGCAAGGGCGAGGGTATCCGTCTTGGCGTGCGCACCACTGGCTGTTCCGGGCTTGCCTATGTCCTCGAATTCGTCGATGAACTGGCGGCCGAGGACTTGGTCTTCGAGAGCCATGGCGTGAAGGTCATCATCGACCCGAAAAGCCTGGTCTATCTCGATGGCACCGAGCTGGACTTCACTCGCGAAGGGCTCAACGAAGGCTTCAAGTTCAACAATCCCAACGTTCGTGGCGAATGCGGCTGCGGCGAAAGCTTCAACGTCTGA
    Protein Properties
    Protein Residues: 107
    Protein Molecular Weight: 11.6 kDa
    Protein Theoretical pI: 4.57
    Hydropathicity (GRAVY score): -0.135
    Charge at pH 7 (predicted): -5.62
    Protein Sequence: 
    >PA3812
MAISMTEAAAKHVQRSLEGRGKGEGIRLGVRTTGCSGLAYVLEFVDELAAEDLVFESHGVKVIIDPKSLVYLDGTELDFTREGLNEGFKFNNPNVRGECGCGESFNV
    References
    External Links:
    Resource Link
    Genome ID: PA3812
    Entrez Gene ID: 879916
    NCBI Protein ID: 15599007
    General Reference: PaperBLAST - Find papers about PA3812 and its homologs