| Identification |
| Name: |
Ribosomal RNA small subunit methyltransferase A |
| Synonyms: |
- 16S rRNA dimethyladenosine transferase
- 16S rRNA dimethylase
- High level kasugamycin resistance protein ksgA
- Kasugamycin dimethyltransferase
- S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase
|
| Gene Name: |
rsmA |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Translation, ribosomal structure and biogenesis |
| Specific Function: |
Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits. Has also a DNA glycosylase/AP lyase activity that removes C mispaired with oxidized T from DNA, and may play a role in protection of DNA against oxidative stress |
| Cellular Location: |
Cytoplasm (Potential) |
| KEGG Pathways: |
|
| KEGG Reactions: |
Not Available |
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
Not Available |
| Transports: |
Not Available |
| Metabolites: |
| PAMDB ID | Name | View |
|---|
| PAMDB000205 | S-Adenosylhomocysteine | MetaboCard | | PAMDB000289 | S-Adenosylmethionine | MetaboCard |
|
| GO Classification: |
| Function |
|---|
| catalytic activity | | methyltransferase activity | | N-methyltransferase activity | | RNA methyltransferase activity | | rRNA (adenine) methyltransferase activity | | rRNA (adenine-N6,N6-)-dimethyltransferase activity | | rRNA methyltransferase activity | | transferase activity | | transferase activity, transferring one-carbon groups | | Process |
|---|
| cellular macromolecule metabolic process | | macromolecule metabolic process | | metabolic process | | ncRNA metabolic process | | RNA metabolic process | | rRNA metabolic process | | rRNA modification | | rRNA processing |
|
| Gene Properties |
| Locus tag: |
PA0905 |
| Strand: |
+ |
| Entrez Gene ID: |
878352 |
| Accession: |
NP_249596.1 |
| GI: |
15596102 |
| Sequence start: |
991013 |
| Sequence End: |
991198 |
| Sequence Length: |
185 |
| Gene Sequence: |
>PA0905
ATGCTGATTCTGACTCGTCGGGTCGGAGAGACCCTGATGGTAGGTGACGACGTCACCGTGACGGTACTGGGTGTCAAAGGGAACCAGGTGCGCATCGGCGTCAACGCGCCGAAGGAAGTCGCCGTACACCGGGAGGAAATTTACCAGCGCATCCAGAAAGAGAAAGATCAAGAGCCAAACCATTAA |
| Protein Properties |
| Protein Residues: |
61 |
| Protein Molecular Weight: |
6.9 kDa |
| Protein Theoretical pI: |
7.7 |
| Hydropathicity (GRAVY score): |
-0.446 |
| Charge at pH 7 (predicted): |
0.46 |
| Protein Sequence: |
>PA0905
MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEKDQEPNH |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA0905 and its homologs
|
