Identification |
Name: |
Dihydroneopterin aldolase |
Synonyms: |
|
Gene Name: |
folB |
Enzyme Class: |
|
Biological Properties |
General Function: |
Involved in dihydroneopterin aldolase activity |
Specific Function: |
Catalyzes the conversion of 7,8-dihydroneopterin to 6- hydroxymethyl-7,8-dihydropterin. Can use L-threo-dihydroneopterin and D-erythro-dihydroneopterin as substrates for the formation of 6-hydroxymethyldihydropterin, but it can also catalyze the epimerization of carbon 2' of dihydroneopterin and dihydromonapterin at appreciable velocity |
Cellular Location: |
Not Available |
KEGG Pathways: |
|
KEGG Reactions: |
|
SMPDB Reactions: |
|
7,8-Dihydroneopterin | + | | → | | + | |
| |
|
PseudoCyc/BioCyc Reactions: |
| | |
| ↔ | |
| |
|
Complex Reactions: |
Not Available |
Transports: |
Not Available |
Metabolites: |
PAMDB ID | Name | View |
---|
PAMDB001880 | 2-Amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine | MetaboCard | PAMDB001590 | 6-Hydroxymethyl dihydropterin | MetaboCard | PAMDB000454 | 7,8-Dihydroneopterin | MetaboCard | PAMDB000444 | Glycolaldehyde | MetaboCard |
|
GO Classification: |
Function |
---|
aldehyde-lyase activity | carbon-carbon lyase activity | catalytic activity | dihydroneopterin aldolase activity | lyase activity | Process |
---|
cellular aromatic compound metabolic process | cellular metabolic process | folic acid and derivative metabolic process | metabolic process |
|
Gene Properties |
Locus tag: |
PA0582 |
Strand: |
+ |
Entrez Gene ID: |
880775 |
Accession: |
NP_249273.1 |
GI: |
15595779 |
Sequence start: |
641073 |
Sequence End: |
641426 |
Sequence Length: |
353 |
Gene Sequence: |
>PA0582
GTGGACAGAGTTTTTATCGAAGGCTTGGAGGTCGATACCGTCATCGGCGTGTACGACTGGGAGCGCGGCATCCGTCAGTGCCTGCGCCTGGACCTGACCCTGGGCTGGGACAACCGTCCGGCCGCCGCGGGCGACGATCTCGCCCTGGCGCTGGACTATGCCGCGTTGTCCGAGCGGGTGCAGGAATTCGCCCGGGAATCGCATTTCCAGTTGGTGGAAACCTTCGCCGAGCGCCTCGCCGAGGTACTGATGGGCGAGCGCGGCATTCCCTGGCTGCGCATCCGCGTGACCAAGCCCGGCGCGGTGCCGGCGGCCCGTGGCGTTGGCGTGGAGATCGAACGCGGATGTCGCTGA |
Protein Properties |
Protein Residues: |
117 |
Protein Molecular Weight: |
13.1 kDa |
Protein Theoretical pI: |
4.64 |
Hydropathicity (GRAVY score): |
-0.054 |
Charge at pH 7 (predicted): |
-4.83 |
Protein Sequence: |
>PA0582
MDRVFIEGLEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAAGDDLALALDYAALSERVQEFARESHFQLVETFAERLAEVLMGERGIPWLRIRVTKPGAVPAARGVGVEIERGCR |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA0582 and its homologs
|