| Identification |
| Name: |
Dihydroneopterin aldolase |
| Synonyms: |
|
| Gene Name: |
folB |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in dihydroneopterin aldolase activity |
| Specific Function: |
Catalyzes the conversion of 7,8-dihydroneopterin to 6- hydroxymethyl-7,8-dihydropterin. Can use L-threo-dihydroneopterin and D-erythro-dihydroneopterin as substrates for the formation of 6-hydroxymethyldihydropterin, but it can also catalyze the epimerization of carbon 2' of dihydroneopterin and dihydromonapterin at appreciable velocity |
| Cellular Location: |
Not Available |
| KEGG Pathways: |
|
| KEGG Reactions: |
|
| SMPDB Reactions: |
|
7,8-Dihydroneopterin | + |  | → |  | + |  |
| |
|
| PseudoCyc/BioCyc Reactions: |
| | |
 | ↔ |  |
| |
|
| Complex Reactions: |
Not Available |
| Transports: |
Not Available |
| Metabolites: |
| PAMDB ID | Name | View |
|---|
| PAMDB001880 | 2-Amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine | MetaboCard | | PAMDB001590 | 6-Hydroxymethyl dihydropterin | MetaboCard | | PAMDB000454 | 7,8-Dihydroneopterin | MetaboCard | | PAMDB000444 | Glycolaldehyde | MetaboCard |
|
| GO Classification: |
| Function |
|---|
| aldehyde-lyase activity | | carbon-carbon lyase activity | | catalytic activity | | dihydroneopterin aldolase activity | | lyase activity | | Process |
|---|
| cellular aromatic compound metabolic process | | cellular metabolic process | | folic acid and derivative metabolic process | | metabolic process |
|
| Gene Properties |
| Locus tag: |
PA0582 |
| Strand: |
+ |
| Entrez Gene ID: |
880775 |
| Accession: |
NP_249273.1 |
| GI: |
15595779 |
| Sequence start: |
641073 |
| Sequence End: |
641426 |
| Sequence Length: |
353 |
| Gene Sequence: |
>PA0582
GTGGACAGAGTTTTTATCGAAGGCTTGGAGGTCGATACCGTCATCGGCGTGTACGACTGGGAGCGCGGCATCCGTCAGTGCCTGCGCCTGGACCTGACCCTGGGCTGGGACAACCGTCCGGCCGCCGCGGGCGACGATCTCGCCCTGGCGCTGGACTATGCCGCGTTGTCCGAGCGGGTGCAGGAATTCGCCCGGGAATCGCATTTCCAGTTGGTGGAAACCTTCGCCGAGCGCCTCGCCGAGGTACTGATGGGCGAGCGCGGCATTCCCTGGCTGCGCATCCGCGTGACCAAGCCCGGCGCGGTGCCGGCGGCCCGTGGCGTTGGCGTGGAGATCGAACGCGGATGTCGCTGA |
| Protein Properties |
| Protein Residues: |
117 |
| Protein Molecular Weight: |
13.1 kDa |
| Protein Theoretical pI: |
4.64 |
| Hydropathicity (GRAVY score): |
-0.054 |
| Charge at pH 7 (predicted): |
-4.83 |
| Protein Sequence: |
>PA0582
MDRVFIEGLEVDTVIGVYDWERGIRQCLRLDLTLGWDNRPAAAGDDLALALDYAALSERVQEFARESHFQLVETFAERLAEVLMGERGIPWLRIRVTKPGAVPAARGVGVEIERGCR |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA0582 and its homologs
|