Identification |
Name: |
Disulfide bond formation protein B |
Synonyms: |
|
Gene Name: |
dsbB |
Enzyme Class: |
Not Available |
Biological Properties |
General Function: |
Involved in protein disulfide oxidoreductase activity |
Specific Function: |
Required for disulfide bond formation in some periplasmic proteins such as phoA or ompA. Acts by oxidizing the dsbA protein |
Cellular Location: |
Cell inner membrane; Multi-pass membrane protein |
KEGG Pathways: |
|
KEGG Reactions: |
Not Available |
SMPDB Reactions: |
Not Available |
PseudoCyc/BioCyc Reactions: |
|
Protein-Red-Disulfides | ↔ | Protein-Ox-Disulfides |
| |
|
Complex Reactions: |
|
| + | periplasmic protein disulfide isomerase I (reduced) | → | | + | periplasmic protein disulfide isomerase I (oxidized) |
| | |
Menaquinone 8 | + | periplasmic protein disulfide isomerase I (reduced) | → | | + | periplasmic protein disulfide isomerase I (oxidized) |
| Menaquinone 8 + periplasmic protein disulfide isomerase I (reduced) → Menaquinol 8 + periplasmic protein disulfide isomerase I (oxidized) ReactionCard |
|
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Component |
---|
cell part | membrane | Function |
---|
catalytic activity | disulfide oxidoreductase activity | oxidoreductase activity | oxidoreductase activity, acting on a sulfur group of donors | protein disulfide oxidoreductase activity |
|
Gene Properties |
Locus tag: |
PA0538 |
Strand: |
- |
Entrez Gene ID: |
878500 |
Accession: |
NP_249229.1 |
GI: |
15595735 |
Sequence start: |
596970 |
Sequence End: |
597479 |
Sequence Length: |
509 |
Gene Sequence: |
>PA0538
TTGAGCGCTCTCCTCAAGCCCCTCGACAATCGCTTGTTCTGGCCCGCGGTCGCCATCGGCGGCCTGCTGATCCTCGCTTTCGTCCTCTACCTCCAGCACGTGCGCGGCTTCGCGCCCTGCTCGCTGTGCATCTTCATTCGCCTGGACGTGCTCGGCCTGGTGCTCGCCGGGATCGTCGGCAGCCTCGCCCCGCGTTCGCGGATCGCCGGCGGCATCGCCGCGCTGGGCATGCTCGCCGCCAGCCTGGGCGGGATCTACCACGCCTGGTCGCTGGTCGCGGAAGAGAAACTGGCTGCCCAGGGCATGGGCAGTTGCAAGATGTTCATGGGCTTCCCCGAATGGATACCGCTGGATACCTGGCTGCCGCAGGTCTTCCAGCCCGAGGGGCTGTGCGGCGAAGTGGTCTGGACCCTGCTCGGCCAGTCCATGGCGGTCTGGTCGCTGGCGCTGTTCGTGTTCTGCCTGCTGGTCCTGGCGGCCAAGCTGGCGTTCGGCCGCCGCACCGCCTGA |
Protein Properties |
Protein Residues: |
169 |
Protein Molecular Weight: |
18.1 kDa |
Protein Theoretical pI: |
8.5 |
Hydropathicity (GRAVY score): |
0.985 |
Charge at pH 7 (predicted): |
3.31 |
Protein Sequence: |
>PA0538
MSALLKPLDNRLFWPAVAIGGLLILAFVLYLQHVRGFAPCSLCIFIRLDVLGLVLAGIVGSLAPRSRIAGGIAALGMLAASLGGIYHAWSLVAEEKLAAQGMGSCKMFMGFPEWIPLDTWLPQVFQPEGLCGEVVWTLLGQSMAVWSLALFVFCLLVLAAKLAFGRRTA |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA0538 and its homologs
|