
RNA pyrophosphohydrolase (PA0336)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
Name: | RNA pyrophosphohydrolase | |||||||||
Synonyms: |
| |||||||||
Gene Name: | rppH | |||||||||
Enzyme Class: | Not Available | |||||||||
Biological Properties | ||||||||||
General Function: | Involved in hydrolase activity | |||||||||
Specific Function: | Master regulator of 5'-dependent mRNA decay. Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage. Preferentially hydrolyzes diadenosine penta-phosphate with ATP as one of the reaction products. Also able to hydrolyze diadenosine hexa- and tetra-phosphate. Has no activity on diadenosine tri-phosphate, ADP-ribose, NADH and UDP- glucose. In the meningitis causing strain E.coli K1, has been shown to play a role in HBMEC (human brain microvascular endothelial cells) invasion in vitro | |||||||||
Cellular Location: | Cytoplasmic | |||||||||
KEGG Pathways: |
| |||||||||
KEGG Reactions: | Not Available | |||||||||
SMPDB Reactions: | Not Available | |||||||||
PseudoCyc/BioCyc Reactions: |
| |||||||||
Complex Reactions: | Not Available | |||||||||
Transports: | Not Available | |||||||||
Metabolites: |
| |||||||||
GO Classification: |
| |||||||||
Gene Properties | ||||||||||
Locus tag: | PA0336 | |||||||||
Strand: | + | |||||||||
Entrez Gene ID: | 882290 | |||||||||
Accession: | NP_249027.1 | |||||||||
GI: | 15595533 | |||||||||
Sequence start: | 378096 | |||||||||
Sequence End: | 378575 | |||||||||
Sequence Length: | 479 | |||||||||
Gene Sequence: |
>PA0336 GTGATCGATTCCGATGGTTTTCGCCCGAATGTCGGCATCATTCTCGCCAACGAGGCGGGGCAGGTGCTGTGGGCGCGGCGTATCAATCAGGAAGCCTGGCAGTTCCCGCAGGGAGGCATCAATGATCGCGAAACGCCGGAAGAGGCGCTGTATCGCGAGTTGAACGAAGAAGTCGGGCTGGAGGCCGGGGACGTGCGCATCCTGGCCTGCACCCGCGGCTGGCTGCGCTACCGTTTGCCGCAGCGCCTGGTGCGGACCCACAGCCAGCCGCTGTGCATCGGCCAGAAGCAGAAATGGTTCCTGCTGCGGCTGATGTCCGACGAGGCGCGCGTGCGCATGGATATCACCAGCAAGCCCGAGTTCGACGGCTGGCGCTGGGTGAGTTACTGGTACCCCCTGGGACAGGTGGTGACCTTCAAGCGCGAGGTCTACCGCCGCGCCCTGAAGGAACTGGCCCCGCGCCTTCTGGCGCGGGACTGA | |||||||||
Protein Properties | ||||||||||
Protein Residues: | 159 | |||||||||
Protein Molecular Weight: | 18.7 kDa | |||||||||
Protein Theoretical pI: | 9.51 | |||||||||
Hydropathicity (GRAVY score): | -0.5 | |||||||||
Charge at pH 7 (predicted): | 4.17 | |||||||||
Protein Sequence: |
>PA0336 MIDSDGFRPNVGIILANEAGQVLWARRINQEAWQFPQGGINDRETPEEALYRELNEEVGLEAGDVRILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRLMSDEARVRMDITSKPEFDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLLARD | |||||||||
References | ||||||||||
External Links: |
| |||||||||
General Reference: | PaperBLAST - Find papers about PA0336 and its homologs |