
50S ribosomal protein L28 (PA5316)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | 50S ribosomal protein L28 | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | rpmB | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | translation | ||||||||
Specific Function: | structural constituent of ribosome | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA5316 | ||||||||
Strand: | - | ||||||||
Entrez Gene ID: | 880891 | ||||||||
Accession: | NP_254003.1 | ||||||||
GI: | 15600509 | ||||||||
Sequence start: | 5985883 | ||||||||
Sequence End: | 5986119 | ||||||||
Sequence Length: | 236 | ||||||||
Gene Sequence: |
>PA5316 ATGTCTAGAGTCTGTCAAGTAACCGGTAAGGGTCCGGTTACCGGGAATAACATTTCCCACGCACACAACAAAACCCGCCGCCGTTTCCTGCCGAACCTGCAGCACCACCGTTTCTGGGTCGAGTCCGAGAAGCGCTTCGTACGTCTGCGCGTTTCCGCCAAGGGCATGCGTATCATCGACAAGCGTGGCATCGAGGCCGTCCTGGCTGACCTGCGTGCCCGCGGCGAAAAATTCTAA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 78 | ||||||||
Protein Molecular Weight: | 9.1 kDa | ||||||||
Protein Theoretical pI: | 12.23 | ||||||||
Hydropathicity (GRAVY score): | -0.655 | ||||||||
Charge at pH 7 (predicted): | 12.91 | ||||||||
Protein Sequence: |
>PA5316 MSRVCQVTGKGPVTGNNISHAHNKTRRRFLPNLQHHRFWVESEKRFVRLRVSAKGMRIIDKRGIEAVLADLRARGEKF | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA5316 and its homologs |