translocation protein TatA (PA5068)

Identification
Name: translocation protein TatA
Synonyms: yigT; mttA
Gene Name: tatA
Enzyme Class: Not Available
Biological Properties
General Function: protein transport by the Tat complex, protein transport, protein secretion
Specific Function: protein transmembrane transporter activity, protein transporter activity, protein transmembrane transporter activity
Cellular Location: Cytoplasmic Membrane
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    TAT protein transport complex
    plasma membrane
    integral component of membrane
    TAT protein transport complex
    Function
    protein transmembrane transporter activity
    protein transporter activity
    protein transmembrane transporter activity
    Process
    protein transport by the Tat complex
    protein transport
    protein secretion
    Gene Properties
    Locus tag: PA5068
    Strand: +
    Entrez Gene ID: 878487
    Accession: NP_253755.1
    GI: 15600261
    Sequence start: 5706552
    Sequence End: 5706800
    Sequence Length: 248
    Gene Sequence: 
    >PA5068
ATGGGCATTTTTGACTGGAAACACTGGATCGTCATCCTGATCGTCGTGGTACTGGTGTTCGGCACCAAGCGCCTGAAGAACCTCGGTTCCGACGTCGGCGAAGCGATCAAGGGCTTCCGCAAGGCGGTGAACACCGAGGAAGACGACAAGAAGGACCAGCCCGCCGCCCAGCCGGCCCAACCGCTGAACCAGCCGCACACCATCGACGCCCAGGCGCAGAAGGTCGAAGAGCCGGCGCGCAAGGACTGA
    Protein Properties
    Protein Residues: 82
    Protein Molecular Weight: 9.2 kDa
    Protein Theoretical pI: 7.7
    Hydropathicity (GRAVY score): -0.474
    Charge at pH 7 (predicted): 0.47
    Protein Sequence: 
    >PA5068
MGIFDWKHWIVILIVVVLVFGTKRLKNLGSDVGEAIKGFRKAVNTEEDDKKDQPAAQPAQPLNQPHTIDAQAQKVEEPARKD
    References
    External Links:
    Resource Link
    Genome ID: PA5068
    Entrez Gene ID: 878487
    NCBI Protein ID: 15600261
    General Reference: PaperBLAST - Find papers about PA5068 and its homologs