50S ribosomal protein L31 (PA5049)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | 50S ribosomal protein L31 | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | rpmE | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | translation | ||||||||
| Specific Function: | 5S rRNA binding, structural constituent of ribosome | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA5049 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 881149 | ||||||||
| Accession: | NP_253736.1 | ||||||||
| GI: | 15600242 | ||||||||
| Sequence start: | 5687105 | ||||||||
| Sequence End: | 5687320 | ||||||||
| Sequence Length: | 215 | ||||||||
| Gene Sequence: |
>PA5049 ATGAAAGCGGACATCCATCCGACTTACGAAGCTATCGAAGCTACCTGCAGCTGCGGTAACGTCATCAAGACCCGTTCCACCCTGTGCAAGCCGATCCACTTGGACGTGTGCTCCGAATGCCACCCGTTCTACACCGGCAAGCAGAAGGTGCTGGACACCGGCGGCCGTATCGACCGCTTCAAGCAGCGTTTCGGCGTATTCGGCGCCACCAAGTAA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 71 | ||||||||
| Protein Molecular Weight: | 7.9 kDa | ||||||||
| Protein Theoretical pI: | 8.77 | ||||||||
| Hydropathicity (GRAVY score): | -0.331 | ||||||||
| Charge at pH 7 (predicted): | 4.55 | ||||||||
| Protein Sequence: |
>PA5049 MKADIHPTYEAIEATCSCGNVIKTRSTLCKPIHLDVCSECHPFYTGKQKVLDTGGRIDRFKQRFGVFGATK | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA5049 and its homologs | ||||||||