Hfq Hfq (PA4944)

Identification
Name: Hfq Hfq
Synonyms: hfq
Gene Name: hfq
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated, regulation of translation, regulation of translation, ncRNA-mediated, pathogenesis, quorum sensing, regulation of RNA stability, regulation of carbon utilization
Specific Function: RNA binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    RNA binding
    Process
    regulation of transcription, DNA-templated
    regulation of translation
    regulation of translation, ncRNA-mediated
    pathogenesis
    quorum sensing
    regulation of RNA stability
    regulation of carbon utilization
    Gene Properties
    Locus tag: PA4944
    Strand: -
    Entrez Gene ID: 878015
    Accession: NP_253631.1
    GI: 15600137
    Sequence start: 5548397
    Sequence End: 5548645
    Sequence Length: 248
    Gene Sequence: 
    >PA4944
ATGTCAAAAGGGCATTCGCTACAAGACCCTTACCTCAATACCCTGCGGAAAGAACGCGTCCCGGTTTCCATCTATCTGGTCAACGGCATCAAGCTGCAAGGCCAGATCGAGTCTTTCGACCAGTTTGTCATCCTGCTGAAGAACACCGTCAGCCAGATGGTTTACAAGCACGCGATCTCCACCGTGGTACCGAGCCGTCCGGTGCGTCTGCCGAGCGGTGACCAGCCGGCCGAGCCGGGCAACGCTTGA
    Protein Properties
    Protein Residues: 82
    Protein Molecular Weight: 9.1 kDa
    Protein Theoretical pI: 10
    Hydropathicity (GRAVY score): -0.244
    Charge at pH 7 (predicted): 3.46
    Protein Sequence: 
    >PA4944
MSKGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAISTVVPSRPVRLPSGDQPAEPGNA
    References
    External Links:
    Resource Link
    Genome ID: PA4944
    Entrez Gene ID: 878015
    NCBI Protein ID: 15600137
    General Reference: PaperBLAST - Find papers about PA4944 and its homologs