
30S ribosomal protein S18 (PA4934)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | 30S ribosomal protein S18 | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | rpsR | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | translation | ||||||||
| Specific Function: | RNA binding, structural constituent of ribosome | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA4934 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 878035 | ||||||||
| Accession: | NP_253621.1 | ||||||||
| GI: | 15600127 | ||||||||
| Sequence start: | 5537059 | ||||||||
| Sequence End: | 5537289 | ||||||||
| Sequence Length: | 230 | ||||||||
| Gene Sequence: |
>PA4934 ATGGCACGTTTCTTCCGTCGTCGTAAGTTCTGCCGCTTCACCGCCGAAGGCGTGAAAGAGATCGATTACAAGGATCTCAACACCCTGAAGGCCTACGTTTCCGAAACCGGCAAGATCGTTCCGAGCCGTATCACCGGCACCAAGGCCAAGTACCAGCGTCAGCTGGCGACCGCTATCAAGCGCGCCCGCTACCTGGCCCTGCTTCCTTACACCGACAGCCACGGCCGTTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 76 | ||||||||
| Protein Molecular Weight: | 8.9 kDa | ||||||||
| Protein Theoretical pI: | 11.06 | ||||||||
| Hydropathicity (GRAVY score): | -0.607 | ||||||||
| Charge at pH 7 (predicted): | 12.19 | ||||||||
| Protein Sequence: |
>PA4934 MARFFRRRKFCRFTAEGVKEIDYKDLNTLKAYVSETGKIVPSRITGTKAKYQRQLATAIKRARYLALLPYTDSHGR | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA4934 and its homologs | ||||||||