30S ribosomal protein S15 (PA4741)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Name: | 30S ribosomal protein S15 | |||||||||
| Synonyms: | Not Available | |||||||||
| Gene Name: | rpsO | |||||||||
| Enzyme Class: | Not Available | |||||||||
| Biological Properties | ||||||||||
| General Function: | cellular protein metabolic process, translation | |||||||||
| Specific Function: | structural constituent of ribosome, RNA binding | |||||||||
| Cellular Location: | Cytoplasmic | |||||||||
| KEGG Pathways: |
| |||||||||
| KEGG Reactions: | Not Available | |||||||||
| SMPDB Reactions: | Not Available | |||||||||
| PseudoCyc/BioCyc Reactions: |
| |||||||||
| Complex Reactions: | Not Available | |||||||||
| Transports: | Not Available | |||||||||
| Metabolites: | Not Available | |||||||||
| GO Classification: |
| |||||||||
| Gene Properties | ||||||||||
| Locus tag: | PA4741 | |||||||||
| Strand: | - | |||||||||
| Entrez Gene ID: | 881675 | |||||||||
| Accession: | NP_253429.1 | |||||||||
| GI: | 15599935 | |||||||||
| Sequence start: | 5325653 | |||||||||
| Sequence End: | 5325922 | |||||||||
| Sequence Length: | 269 | |||||||||
| Gene Sequence: |
>PA4741 ATGGCACTGAGCGTTGAAGAAAAAGCGCAGATCGTTAACGAATACAAGCAAGCTGAAGGCGACACCGGTTCCCCGGAAGTGCAGGTAGCCCTGCTGTCCGCCAACATCAACAAGCTGCAGGATCACTTCAAGGCCAACGGCAAGGATCACCATTCCCGCCGTGGTCTGATCCGTATGGTTAACCAGCGCCGTAAGCTGCTGGACTACCTGAAGGGCAAAGACGTGTCTCGCTACACTGCCCTGATCGGCCGTCTGGGTCTGCGTCGCTAA | |||||||||
| Protein Properties | ||||||||||
| Protein Residues: | 89 | |||||||||
| Protein Molecular Weight: | 10.1 kDa | |||||||||
| Protein Theoretical pI: | 10.69 | |||||||||
| Hydropathicity (GRAVY score): | -0.683 | |||||||||
| Charge at pH 7 (predicted): | 7.7 | |||||||||
| Protein Sequence: |
>PA4741 MALSVEEKAQIVNEYKQAEGDTGSPEVQVALLSANINKLQDHFKANGKDHHSRRGLIRMVNQRRKLLDYLKGKDVSRYTALIGRLGLRR | |||||||||
| References | ||||||||||
| External Links: |
| |||||||||
| General Reference: | PaperBLAST - Find papers about PA4741 and its homologs | |||||||||