
50S ribosomal protein L22 (PA4258)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | 50S ribosomal protein L22 | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | rplV | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | cellular protein metabolic process, translation | ||||||||
Specific Function: | structural constituent of ribosome | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA4258 | ||||||||
Strand: | - | ||||||||
Entrez Gene ID: | 881762 | ||||||||
Accession: | NP_252948.1 | ||||||||
GI: | 15599454 | ||||||||
Sequence start: | 4764243 | ||||||||
Sequence End: | 4764575 | ||||||||
Sequence Length: | 332 | ||||||||
Gene Sequence: |
>PA4258 ATGGAAGTAGCCGCTAAGCTGTCGGGCGCTCGTATCTCCGCCCAGAAAGCCCGCTTGGTCGCCGACCAGATCCGCGGGAAGAAGGTGGGCGAAGCGCTCAACCTCCTGGCTTTCAGCAGTAAGAAAGCCGCCGAGATCATGAAGAAAGTGCTGGAGTCGGCCGTTGCCAACGCTGAGCACAACGAAGGCGCCGATGTGGATGACCTGAAGGTCTCCACCGTCTTCGTCAACGAAGGTCGTTCGCTCAAGCGCATCATGCCGCGTGCCAAAGGCCGTGCTGATCGCATCGTGAAGCGGTCTTGCCATATCACGGTCAAGGTTGCGGACAAGTAA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 110 | ||||||||
Protein Molecular Weight: | 11.9 kDa | ||||||||
Protein Theoretical pI: | 10.9 | ||||||||
Hydropathicity (GRAVY score): | -0.251 | ||||||||
Charge at pH 7 (predicted): | 10.44 | ||||||||
Protein Sequence: |
>PA4258 MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVLESAVANAEHNEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA4258 and its homologs |