
30S ribosomal protein S17 (PA4254)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | 30S ribosomal protein S17 | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | rpsQ | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | cellular protein metabolic process, translation | ||||||||
| Specific Function: | structural constituent of ribosome | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA4254 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 881770 | ||||||||
| Accession: | NP_252944.1 | ||||||||
| GI: | 15599450 | ||||||||
| Sequence start: | 4762659 | ||||||||
| Sequence End: | 4762925 | ||||||||
| Sequence Length: | 266 | ||||||||
| Gene Sequence: |
>PA4254 ATGGCTGAAGCTCAGAAAACCGTCCGTACGCTGACCGGCCGCGTCGTCAGCGACAAAATGGACAAGACCGTCACCGTACTGATCGAGCGTCGCGTCAAGCACCCGATCTACGGCAAATACGTCAAGCGTTCGACCAAACTGCACGCACACGACGAATCCAATCAGTGCCGCATTGGTGACCTGGTCACCATTCGCGAAACCCGTCCGCTGGCCAAGACCAAGGCCTGGACCCTGGTTGATATCGTTGAACGCGCGGTGGAAGTCTAA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 88 | ||||||||
| Protein Molecular Weight: | 10.1 kDa | ||||||||
| Protein Theoretical pI: | 10.58 | ||||||||
| Hydropathicity (GRAVY score): | -0.44 | ||||||||
| Charge at pH 7 (predicted): | 7.67 | ||||||||
| Protein Sequence: |
>PA4254 MAEAQKTVRTLTGRVVSDKMDKTVTVLIERRVKHPIYGKYVKRSTKLHAHDESNQCRIGDLVTIRETRPLAKTKAWTLVDIVERAVEV | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA4254 and its homologs | ||||||||