50S ribosomal protein L30 (PA4245)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | 50S ribosomal protein L30 | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | rpmD | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | cellular protein metabolic process, translation | ||||||||
| Specific Function: | structural constituent of ribosome | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA4245 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 881787 | ||||||||
| Accession: | NP_252935.1 | ||||||||
| GI: | 15599441 | ||||||||
| Sequence start: | 4758891 | ||||||||
| Sequence End: | 4759067 | ||||||||
| Sequence Length: | 176 | ||||||||
| Gene Sequence: |
>PA4245 ATGGCAACTGTCAAAGTCACTCTGGTCAAGAGCCTGAACGGCCGTCTGGCCAATCACAAGGCTTGCGTCAAGGGTCTCGGCCTGCGTCGCATCAATCATACCGTCGAAGTTCAGGACACTCCTGAGAACCGCGGCATGATCAACAAGGCCTACTACCTGCTGCGTGTGGAGGGTTAA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 58 | ||||||||
| Protein Molecular Weight: | 6.5 kDa | ||||||||
| Protein Theoretical pI: | 10.73 | ||||||||
| Hydropathicity (GRAVY score): | -0.253 | ||||||||
| Charge at pH 7 (predicted): | 6.43 | ||||||||
| Protein Sequence: |
>PA4245 MATVKVTLVKSLNGRLANHKACVKGLGLRRINHTVEVQDTPENRGMINKAYYLLRVEG | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA4245 and its homologs | ||||||||