antirepressor for MexR, ArmR (PA3719)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | antirepressor for MexR, ArmR | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | armR | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | positive regulation of transporter activity | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Unknown | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA3719 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 880376 | ||||||||
| Accession: | NP_252408.1 | ||||||||
| GI: | 15598914 | ||||||||
| Sequence start: | 4165719 | ||||||||
| Sequence End: | 4165880 | ||||||||
| Sequence Length: | 161 | ||||||||
| Gene Sequence: |
>PA3719 ATGTCCCTGAACACTCCGCGCAACAAACCGTCCCGCACCGAGACCGAAGCTGTCGCTGCCAGCTCGGGACGATCCGCCGTCGGCCGGCGGGATTACACCGAGCAGCTGCGCCGGGCAGCCCGGCGCAATGCCTGGGACCTCTACGGCGAGCACTTCTACTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 53 | ||||||||
| Protein Molecular Weight: | 6.1 kDa | ||||||||
| Protein Theoretical pI: | 10.72 | ||||||||
| Hydropathicity (GRAVY score): | -1.16 | ||||||||
| Charge at pH 7 (predicted): | 4.22 | ||||||||
| Protein Sequence: |
>PA3719 MSLNTPRNKPSRTETEAVAASSGRSAVGRRDYTEQLRRAARRNAWDLYGEHFY | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA3719 and its homologs | ||||||||