
antirepressor for MexR, ArmR (PA3719)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | antirepressor for MexR, ArmR | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | armR | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | positive regulation of transporter activity | ||||||||
Specific Function: | Not Available | ||||||||
Cellular Location: | Unknown | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA3719 | ||||||||
Strand: | - | ||||||||
Entrez Gene ID: | 880376 | ||||||||
Accession: | NP_252408.1 | ||||||||
GI: | 15598914 | ||||||||
Sequence start: | 4165719 | ||||||||
Sequence End: | 4165880 | ||||||||
Sequence Length: | 161 | ||||||||
Gene Sequence: |
>PA3719 ATGTCCCTGAACACTCCGCGCAACAAACCGTCCCGCACCGAGACCGAAGCTGTCGCTGCCAGCTCGGGACGATCCGCCGTCGGCCGGCGGGATTACACCGAGCAGCTGCGCCGGGCAGCCCGGCGCAATGCCTGGGACCTCTACGGCGAGCACTTCTACTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 53 | ||||||||
Protein Molecular Weight: | 6.1 kDa | ||||||||
Protein Theoretical pI: | 10.72 | ||||||||
Hydropathicity (GRAVY score): | -1.16 | ||||||||
Charge at pH 7 (predicted): | 4.22 | ||||||||
Protein Sequence: |
>PA3719 MSLNTPRNKPSRTETEAVAASSGRSAVGRRDYTEQLRRAARRNAWDLYGEHFY | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA3719 and its homologs |