
conserved hypothetical protein (PA3601)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | conserved hypothetical protein | ||||||||
| Synonyms: | ykgM | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | translation | ||||||||
| Specific Function: | structural constituent of ribosome | ||||||||
| Cellular Location: | Unknown | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA3601 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 880137 | ||||||||
| Accession: | NP_252291.1 | ||||||||
| GI: | 15598797 | ||||||||
| Sequence start: | 4035758 | ||||||||
| Sequence End: | 4036021 | ||||||||
| Sequence Length: | 263 | ||||||||
| Gene Sequence: |
>PA3601 ATGAAACCCGGCATCCATCCCGAATACCGTCCCGTCCTGTTCCATGACACCTCGGCCGACGTGTACTTCCTGATCGGCTCCACCGCGGAGACCGACAAGACCCATACCCATACCGACGGCAAGACCTATCCCTACGTGACGCTGGACGTTTCCAGCGCCTCGCACCCGGTCTACACCGGCGAACAGCGCAAGACCAAGAGCGAAGGCCGCGTGGCCGGGTTCAACAAGCGTTTCGCCGGCTTCGTCGGCGGCAAGGGGGCCTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 87 | ||||||||
| Protein Molecular Weight: | 9.5 kDa | ||||||||
| Protein Theoretical pI: | 9.41 | ||||||||
| Hydropathicity (GRAVY score): | -0.616 | ||||||||
| Charge at pH 7 (predicted): | 3.18 | ||||||||
| Protein Sequence: |
>PA3601 MKPGIHPEYRPVLFHDTSADVYFLIGSTAETDKTHTHTDGKTYPYVTLDVSSASHPVYTGEQRKTKSEGRVAGFNKRFAGFVGGKGA | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA3601 and its homologs | ||||||||