
conserved hypothetical protein (PA3600)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | conserved hypothetical protein | ||||||||
Synonyms: | rpl36 | ||||||||
Gene Name: | Not Available | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | translation | ||||||||
Specific Function: | structural constituent of ribosome | ||||||||
Cellular Location: | Unknown | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA3600 | ||||||||
Strand: | - | ||||||||
Entrez Gene ID: | 880142 | ||||||||
Accession: | NP_252290.1 | ||||||||
GI: | 15598796 | ||||||||
Sequence start: | 4035606 | ||||||||
Sequence End: | 4035758 | ||||||||
Sequence Length: | 152 | ||||||||
Gene Sequence: |
>PA3600 ATGAAAGTCCTCGCCTCGCTGAAACAGGCCAAGCTGCGCCATCGCGATTGCCAGGTGGTGAAGCGCCGTGGCCGGCTCTACGTGATCTGCAAGTCGAATCCGCGCTTCAAGTGCGTGCAGGGCCGGCCGAAGCCGAAGATCAAGCGCCGCTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 50 | ||||||||
Protein Molecular Weight: | 6 kDa | ||||||||
Protein Theoretical pI: | 12.26 | ||||||||
Hydropathicity (GRAVY score): | -0.876 | ||||||||
Charge at pH 7 (predicted): | 17.12 | ||||||||
Protein Sequence: |
>PA3600 MKVLASLKQAKLRHRDCQVVKRRGRLYVICKSNPRFKCVQGRPKPKIKRR | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA3600 and its homologs |