probable molybdopterin-binding protein (PA3441)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Name: | probable molybdopterin-binding protein | |||||||||
| Synonyms: | ssuF | |||||||||
| Gene Name: | Not Available | |||||||||
| Enzyme Class: | Not Available | |||||||||
| Biological Properties | ||||||||||
| General Function: | transport | |||||||||
| Specific Function: | molybdenum ion binding, transporter activity, ATP binding, hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances | |||||||||
| Cellular Location: | Unknown | |||||||||
| KEGG Pathways: |
| |||||||||
| KEGG Reactions: | Not Available | |||||||||
| SMPDB Reactions: | Not Available | |||||||||
| PseudoCyc/BioCyc Reactions: |
| |||||||||
| Complex Reactions: | Not Available | |||||||||
| Transports: | Not Available | |||||||||
| Metabolites: | Not Available | |||||||||
| GO Classification: |
| |||||||||
| Gene Properties | ||||||||||
| Locus tag: | PA3441 | |||||||||
| Strand: | - | |||||||||
| Entrez Gene ID: | 879139 | |||||||||
| Accession: | NP_252131.1 | |||||||||
| GI: | 15598637 | |||||||||
| Sequence start: | 3847718 | |||||||||
| Sequence End: | 3847933 | |||||||||
| Sequence Length: | 215 | |||||||||
| Gene Sequence: |
>PA3441 ATGACCATCAAAGCCATCAACGTTCGTAACCAGTTCAAGGGCACCGTGAAGGAAATCATCGAAGGGCCGGTGCTCTCCGAGATCGACGTGCAGACCGCTGCCGGGATCGTCACTTCGGTGATCACCACGCGTTCGGTGAAGGAACTGGAGCTGGCCATCGGTAGCGAAGTGATCGCCTTCGTCAAGTCCACCGAGGTCTCCATCGCCAAGCTGTGA | |||||||||
| Protein Properties | ||||||||||
| Protein Residues: | 71 | |||||||||
| Protein Molecular Weight: | 7.6 kDa | |||||||||
| Protein Theoretical pI: | 6.81 | |||||||||
| Hydropathicity (GRAVY score): | 0.468 | |||||||||
| Charge at pH 7 (predicted): | -0.02 | |||||||||
| Protein Sequence: |
>PA3441 MTIKAINVRNQFKGTVKEIIEGPVLSEIDVQTAAGIVTSVITTRSVKELELAIGSEVIAFVKSTEVSIAKL | |||||||||
| References | ||||||||||
| External Links: |
| |||||||||
| General Reference: | PaperBLAST - Find papers about PA3441 and its homologs | |||||||||