fucose-binding lectin PA-IIL LecB (PA3361)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | fucose-binding lectin PA-IIL LecB | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | lecB | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | movement of cell or subcellular component, single-species biofilm formation | ||||||||
| Specific Function: | carbohydrate binding | ||||||||
| Cellular Location: | Outer Membrane | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA3361 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 882528 | ||||||||
| Accession: | NP_252051.1 | ||||||||
| GI: | 15598557 | ||||||||
| Sequence start: | 3773029 | ||||||||
| Sequence End: | 3773376 | ||||||||
| Sequence Length: | 347 | ||||||||
| Gene Sequence: |
>PA3361 ATGGCAACACAAGGAGTGTTCACCCTTCCCGCCAACACCCGGTTCGGCGTCACCGCCTTCGCCAACTCGTCCGGAACCCAGACGGTGAACGTGCTGGTCAACAACGAGACGGCCGCGACCTTCAGCGGGCAAAGCACCAATAACGCCGTCATCGGCACCCAGGTGCTCAACTCCGGCAGCAGTGGCAAGGTACAGGTCCAGGTCAGCGTCAACGGCCGCCCCTCGGATCTGGTCTCGGCACAGGTAATCCTGACCAACGAGCTGAACTTCGCCCTGGTCGGCTCTGAAGACGGCACCGACAACGACTACAACGACGCCGTCGTGGTGATCAACTGGCCGCTCGGCTAG | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 115 | ||||||||
| Protein Molecular Weight: | 11.9 kDa | ||||||||
| Protein Theoretical pI: | 3.83 | ||||||||
| Hydropathicity (GRAVY score): | 0.054 | ||||||||
| Charge at pH 7 (predicted): | -5.02 | ||||||||
| Protein Sequence: |
>PA3361 MATQGVFTLPANTRFGVTAFANSSGTQTVNVLVNNETAATFSGQSTNNAVIGTQVLNSGSSGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA3361 and its homologs | ||||||||