integration host factor beta subunit (PA3161)

Identification
Name: integration host factor beta subunit
Synonyms: Not Available
Gene Name: himD
Enzyme Class: Not Available
Biological Properties
General Function: DNA metabolic process, RNA metabolic process, cellular protein metabolic process, regulation of transcription, DNA-templated, DNA recombination
Specific Function: DNA binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    chromosome
    Function
    DNA binding
    Process
    DNA metabolic process
    RNA metabolic process
    cellular protein metabolic process
    regulation of transcription, DNA-templated
    DNA recombination
    Gene Properties
    Locus tag: PA3161
    Strand: -
    Entrez Gene ID: 882561
    Accession: NP_251851.1
    GI: 15598357
    Sequence start: 3547689
    Sequence End: 3547973
    Sequence Length: 284
    Gene Sequence: 
    >PA3161
ATGACCAAGTCGGAGTTGATCGAACGGATCGTTACCCATCAGGGGCAACTGTCCGCGAAGGATGTCGAGTTGGCAATCAAGACCATGCTGGAGCAAATGTCCCAGGCCCTGGCGACCGGGGACCGGATCGAGATCCGTGGCTTCGGCAGCTTTTCCTTGCACTACCGCGCCCCGCGCGTCGGTCGCAACCCCAAGACCGGGGAGTCGGTACGCCTCGACGGCAAGTTCGTGCCGCACTTCAAGCCGGGCAAGGAGTTGCGGGATCGGGTCAACGAGCCGGAGTGA
    Protein Properties
    Protein Residues: 94
    Protein Molecular Weight: 10.6 kDa
    Protein Theoretical pI: 10.21
    Hydropathicity (GRAVY score): -0.646
    Charge at pH 7 (predicted): 3.71
    Protein Sequence: 
    >PA3161
MTKSELIERIVTHQGQLSAKDVELAIKTMLEQMSQALATGDRIEIRGFGSFSLHYRAPRVGRNPKTGESVRLDGKFVPHFKPGKELRDRVNEPE
    References
    External Links:
    Resource Link
    Genome ID: PA3161
    Entrez Gene ID: 882561
    NCBI Protein ID: 15598357
    General Reference: PaperBLAST - Find papers about PA3161 and its homologs