conserved hypothetical protein (PA2737)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | conserved hypothetical protein | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | regulation of transcription, DNA-templated | ||||||||
| Specific Function: | DNA binding | ||||||||
| Cellular Location: | Unknown | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA2737 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 882953 | ||||||||
| Accession: | NP_251427 | ||||||||
| GI: | 15597933 | ||||||||
| Sequence start: | 3099473 | ||||||||
| Sequence End: | 3099730 | ||||||||
| Sequence Length: | 257 | ||||||||
| Gene Sequence: |
>PA2737 GTGCTGCGCTACTGGGAGCAGGAATTCCCGCAGCTCAACCCGGTGAAGCGCCGCGGAAATCGCCGCTATTATCAGCGCCAGGACGTGCTGATGATCCGCCAGATCCGCGCGCTCCTCTACGACCAGGGCTTCACCATCGGCGGGGCGCGCCAGCGCCTCTCCGGCGACGAGGCCAAGGACGACGTCACCCAGTACAAGCAGCTCATCCGCCAGATGATCGCCGAGCTGGAAGAAGTCCTGCTGGTCCTGAAGAAGTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 85 | ||||||||
| Protein Molecular Weight: | 10.3 kDa | ||||||||
| Protein Theoretical pI: | 10.24 | ||||||||
| Hydropathicity (GRAVY score): | -0.685 | ||||||||
| Charge at pH 7 (predicted): | 4.98 | ||||||||
| Protein Sequence: |
>PA2737 MLRYWEQEFPQLNPVKRRGNRRYYQRQDVLMIRQIRALLYDQGFTIGGARQRLSGDEAKDDVTQYKQLIRQMIAELEEVLLVLKK | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA2737 and its homologs | ||||||||