
ClpS (PA2621)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | ClpS | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | clpS | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | bacterial-type flagellum-dependent swarming motility, cellular response to antibiotic, single-species biofilm formation, single-species biofilm formation on inanimate substrate, protein catabolic process | ||||||||
Specific Function: | Not Available | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA2621 | ||||||||
Strand: | - | ||||||||
Entrez Gene ID: | 882327 | ||||||||
Accession: | NP_251311 | ||||||||
GI: | 161486763 | ||||||||
Sequence start: | 2964607 | ||||||||
Sequence End: | 2964843 | ||||||||
Sequence Length: | 236 | ||||||||
Gene Sequence: |
>PA2621 GTGGTACTGTTCAACGACGATTACACGCCGATGGACTTTGTTGTTGAAGTGCTGGAAGTGTTCTTCAACATGGACCGGGAAAAAGCCACCAAGATCATGTTGACGGTACATACTCAGGGTAAGGCGGTCTGCGGCTTGTTTACCCGGGACGTGGCCGAAACCAAGGCGATGCAGGTCAATCAGTATGCACGGGAGAGCCAGCATCCATTGCTCTGCGAGATAGAGAAAGACAGTTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 78 | ||||||||
Protein Molecular Weight: | 9 kDa | ||||||||
Protein Theoretical pI: | 4.55 | ||||||||
Hydropathicity (GRAVY score): | -0.159 | ||||||||
Charge at pH 7 (predicted): | -4.59 | ||||||||
Protein Sequence: |
>PA2621 MVLFNDDYTPMDFVVEVLEVFFNMDREKATKIMLTVHTQGKAVCGLFTRDVAETKAMQVNQYARESQHPLLCEIEKDS | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA2621 and its homologs |