
SrfA (PA2559.1)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | SrfA | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | srfA | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | cellular response to cell envelope stress | ||||||||
Specific Function: | Not Available | ||||||||
Cellular Location: | Not Available | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA2559.1 | ||||||||
Strand: | + | ||||||||
Entrez Gene ID: | 17373363 | ||||||||
Accession: | YP_008719755.1 | ||||||||
GI: | Not Available | ||||||||
Sequence start: | 2894147 | ||||||||
Sequence End: | 2894377 | ||||||||
Sequence Length: | 230 | ||||||||
Gene Sequence: |
>PA2559.1 ATGGCTGAACCCCAGGACAAGTACACCCGGCGCACAGGCAGGACCTGGGCGGACGACCAGGCGACCTACAACCGTCTGCGCGAAGAAGCCGACGCCGCTCGCCAGAAGCTGCGCGAAAGCGGCTACAGCGGCGCCGAGTACGACCAGTTGCGTCAAGCCGCCTTCGATCTCAACCGCAAGGCCAACCAGTACTGGGAGCAGATGCTCAGCGACCTGCGCCAGGAAGACTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 76 | ||||||||
Protein Molecular Weight: | Not Available kDa | ||||||||
Protein Theoretical pI: | Not Available | ||||||||
Hydropathicity (GRAVY score): | Not Available | ||||||||
Charge at pH 7 (predicted): | Not Available | ||||||||
Protein Sequence: |
>PA2559.1 MAEPQDKYTRRTGRTWADDQATYNRLREEADAARQKLRESGYSGAEYDQLRQAAFDLNRKANQYWEQMLSDLRQED | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA2559.1 and its homologs |