
fimbrial subunit CupA1 probable fimbrial protein (precursor); component of adhesin (PA2128)
Identification | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Name: | fimbrial subunit CupA1 probable fimbrial protein (precursor); component of adhesin | ||||||||||||
Synonyms: | Not Available | ||||||||||||
Gene Name: | cupA1 | ||||||||||||
Enzyme Class: | Not Available | ||||||||||||
Biological Properties | |||||||||||||
General Function: | movement of cell or subcellular component, cell adhesion, cellular response to sodium dodecyl sulfate, cell aggregation, cellular response to oxygen levels, cellular response to organic cyclic compound, cellular response to organic cyclic compound, pathogenesis, cellular response to oxygen levels | ||||||||||||
Specific Function: | Not Available | ||||||||||||
Cellular Location: | Extracellular | ||||||||||||
KEGG Pathways: |
| ||||||||||||
KEGG Reactions: | Not Available | ||||||||||||
SMPDB Reactions: | Not Available | ||||||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||||||
Complex Reactions: | Not Available | ||||||||||||
Transports: | Not Available | ||||||||||||
Metabolites: | Not Available | ||||||||||||
GO Classification: |
| ||||||||||||
Gene Properties | |||||||||||||
Locus tag: | PA2128 | ||||||||||||
Strand: | + | ||||||||||||
Entrez Gene ID: | 880862 | ||||||||||||
Accession: | NP_250818.1 | ||||||||||||
GI: | 15597324 | ||||||||||||
Sequence start: | 2342493 | ||||||||||||
Sequence End: | 2343044 | ||||||||||||
Sequence Length: | 551 | ||||||||||||
Gene Sequence: |
>PA2128 ATGACCAGAACTTCGAACCCATGCGCAGTGGTATTGGCCTTTGCGGCAATTGCCGCTTCGGGAACCGCGATGGCGGCAAACACTATCACATTCAGCGGCGAAGTGACCGACCAGACCTGCCAGGTCGCGGTCAACGGCTTCACCGACCCCACGGTGATCCTCGACAGCGTACCGGTGAGCGCCCTCGATGGCGCAGTGGGCCGCAGCGCCGGCGAAACCGCCTTCACCCTGCAACTCACCGATTGCGTCGCGCCGACGGCCGACGAGCATTTCACCACCCTGTTCCAGGCCACCAACCCCAGCGCCGCCGGGAACCTGGTGAACACCGCCGCCAGCGGCGCGACGGGCGTGGCGCTGCAATTGCTCGATAGCGTCGGCGGCAACCCGGTCGACCTGGCCGGCGGCGCGGCGGTGCCCGCCGGCGACATCGTGCTCGCCAACGGAGCCACCAGCACCAGCTACGACTACGCGGTGCAGTACGTCTCCGAAGCGGCGACCGTGACGCCCGGTCCGGTACTCGGCGTCGTGACCTACACGCTGCGTTACGAGTGA | ||||||||||||
Protein Properties | |||||||||||||
Protein Residues: | 183 | ||||||||||||
Protein Molecular Weight: | 18.2 kDa | ||||||||||||
Protein Theoretical pI: | 3.59 | ||||||||||||
Hydropathicity (GRAVY score): | 0.421 | ||||||||||||
Charge at pH 7 (predicted): | -11.87 | ||||||||||||
Protein Sequence: |
>PA2128 MTRTSNPCAVVLAFAAIAASGTAMAANTITFSGEVTDQTCQVAVNGFTDPTVILDSVPVSALDGAVGRSAGETAFTLQLTDCVAPTADEHFTTLFQATNPSAAGNLVNTAASGATGVALQLLDSVGGNPVDLAGGAAVPAGDIVLANGATSTSYDYAVQYVSEAATVTPGPVLGVVTYTLRYE | ||||||||||||
References | |||||||||||||
External Links: |
| ||||||||||||
General Reference: | PaperBLAST - Find papers about PA2128 and its homologs |