Ribonuclease HI (PA1815)

Identification
Name: Ribonuclease HI
Synonyms:
  • RNase HI
  • Ribonuclease H
  • RNase H
Gene Name: rnhA
Enzyme Class:
Biological Properties
General Function: Involved in ribonuclease H activity
Specific Function: Endonuclease that specifically degrades the RNA of RNA- DNA hybrids. RNase H participates in DNA replication; it helps to specify the origin of genomic replication by suppressing initiation at origins other than the oriC locus; along with the 5'-3' exonuclease of pol1, it removes RNA primers from the Okazaki fragments of lagging strand synthesis; and it defines the origin of replication for ColE1-type plasmids by specific cleavage of an RNA preprimer
Cellular Location: Cytoplasm (Potential)
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Thumb ? a nucleoside monophosphate
    Water ? a nucleoside monophosphate
    ReactionCard
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites:
    PAMDB IDNameView
    PAMDB000142WaterMetaboCard
    GO Classification:
    Function
    binding
    catalytic activity
    endonuclease activity
    endoribonuclease activity
    endoribonuclease activity, producing 5'-phosphomonoesters
    hydrolase activity
    hydrolase activity, acting on ester bonds
    nuclease activity
    nucleic acid binding
    ribonuclease H activity
    Gene Properties
    Locus tag: PA1815
    Strand: +
    Entrez Gene ID: 878252
    Accession: NP_250506.1
    GI: 15597012
    Sequence start: 1972959
    Sequence End: 1973405
    Sequence Length: 446
    Gene Sequence: 
    >PA1815
ATGACAGATAAAGAACAGGTAGTGATCTATACCGACGGCGCCTGCAAGGGCAACCCTGGGCGCGGCGGCTGGGGGGCGTTGCTCCTCTACAAGGGCGCCGAGCGAGAGCTTTGGGGCGGCGAGCCGGACACCACCAACAACCGCATGGAGCTGATGGCGGCGATCCAGGCGCTGGCGGCACTCAAGCGTTCCTGTCCGATCCGTCTGATCACCGACTCGGAATACGTGATGCGCGGCATCACCGAATGGTTGCCGAACTGGAAGAAGCGCGGCTGGAAGACCGCCAGCAAGCAGCCGGTCAAGAATGCCGACCTCTGGCAGGCCCTGGATGAACAGGTCGCCCGGCACCAGGTGGAGTGGCAGTGGGTCCGCGGGCATACCGGCGACCCCGGCAACGAGCGGGCCGACCAGTTGGCCAACCGTGGCGTCGCCGAATTGCCGCGCTGA
    Protein Properties
    Protein Residues: 148
    Protein Molecular Weight: 16.7 kDa
    Protein Theoretical pI: 8.72
    Hydropathicity (GRAVY score): -0.714
    Charge at pH 7 (predicted): 2.41
    Protein Sequence: 
    >PA1815
MTDKEQVVIYTDGACKGNPGRGGWGALLLYKGAERELWGGEPDTTNNRMELMAAIQALAALKRSCPIRLITDSEYVMRGITEWLPNWKKRGWKTASKQPVKNADLWQALDEQVARHQVEWQWVRGHTGDPGNERADQLANRGVAELPR
    References
    External Links:
    Resource Link
    Genome ID: PA1815
    Entrez Gene ID: 878252
    NCBI Protein ID: 15597012
    General Reference: PaperBLAST - Find papers about PA1815 and its homologs