
ExsE (PA1711)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | ExsE | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | exsE | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | negative regulation of protein secretion, protein secretion by the type III secretion system, cellular response to calcium ion | ||||||||
Specific Function: | chaperone binding | ||||||||
Cellular Location: | Unknown | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA1711 | ||||||||
Strand: | + | ||||||||
Entrez Gene ID: | 880941 | ||||||||
Accession: | NP_250402.1 | ||||||||
GI: | 15596908 | ||||||||
Sequence start: | 1856308 | ||||||||
Sequence End: | 1856553 | ||||||||
Sequence Length: | 245 | ||||||||
Gene Sequence: |
>PA1711 ATGAAAATCGAATCGATTTCGCCGGTGCAGCCGTCCCAAGACGCTGGAGCCGAGGCGGTGGGGCATTTCGAGGGGCGTTCGGTGACCCGCGCGGCCGTTCGCGGCGAGGACCGTTCCAGCGTGGCCGGGCTGGCGCGCTGGCTGGCGCGCAACGTGGCTGGCGATCCGCGTAGTGAGCAGGCCTTGCAGCGTCTCGCCGACGGTGACGGCACGCCGCTGGAGGCGCGCACGGTCCGGCGCAGGTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 81 | ||||||||
Protein Molecular Weight: | 8.7 kDa | ||||||||
Protein Theoretical pI: | 11.01 | ||||||||
Hydropathicity (GRAVY score): | -0.637 | ||||||||
Charge at pH 7 (predicted): | 2.23 | ||||||||
Protein Sequence: |
>PA1711 MKIESISPVQPSQDAGAEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA1711 and its homologs |