
OrfX (PA1664)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | OrfX | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | orfX | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | protein secretion by the type VI secretion system | ||||||||
Specific Function: | Not Available | ||||||||
Cellular Location: | Unknown | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA1664 | ||||||||
Strand: | + | ||||||||
Entrez Gene ID: | 880635 | ||||||||
Accession: | NP_250355.1 | ||||||||
GI: | 15596861 | ||||||||
Sequence start: | 1814995 | ||||||||
Sequence End: | 1815135 | ||||||||
Sequence Length: | 140 | ||||||||
Gene Sequence: |
>PA1664 ATGCCTGTTCGTCACTGGCCCGCCGTGCTTCTGGCCCTGGCCGTCCTCTGCGGCCTCGCCGGTTGCAGCGGCAACTACAAATTCAACGACGGCGACTATCGCCCGCTTGGCGATCCGCAGGCGGTCAATCGCGGCAAGTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 46 | ||||||||
Protein Molecular Weight: | 4.9 kDa | ||||||||
Protein Theoretical pI: | 8.77 | ||||||||
Hydropathicity (GRAVY score): | -0.083 | ||||||||
Charge at pH 7 (predicted): | 2.16 | ||||||||
Protein Sequence: |
>PA1664 MPVRHWPAVLLALAVLCGLAGCSGNYKFNDGDYRPLGDPQAVNRGK | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA1664 and its homologs |